PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100163870051 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 202aa MW: 23422.2 Da PI: 5.0968 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 117 | 1.9e-36 | 10 | 121 | 1 | 116 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lppGfrF P+deelv++yL+kk+++++ +l ++ e+d++ +ePw+Lp +k +++ewyfFs rd+kyatg r+nrat+sg Ote100163870051|100163870051 10 LPPGFRFYPSDEELVCHYLQKKIANEEGDLRGTLVEIDLHVCEPWQLPDVAKLNSNEWYFFSFRDRKYATGYRTNRATSSG 90 79*************************999999***************87778899************************* PP NAM 82 yWkatgkdkevlskkgelvglkktLvfykgrapkg 116 yWkatgkd++vl+ + v ++ vfyk r ++g Ote100163870051|100163870051 91 YWKATGKDRNVLD-PEDWVLCR---VFYKSRGENG 121 ************9.56667776...7888777776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.79E-39 | 8 | 115 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 34.702 | 10 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-17 | 11 | 102 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MGLRDIGCTL PPGFRFYPSD EELVCHYLQK KIANEEGDLR GTLVEIDLHV CEPWQLPDVA 60 KLNSNEWYFF SFRDRKYATG YRTNRATSSG YWKATGKDRN VLDPEDWVLC RVFYKSRGEN 120 GNNFIPQDLY DQSPTVESPR TKFQNVLPIN SHQNMVTSSF FEGQNPSSFF ECNKNVVSRP 180 STSKCDDDYG FLFDMSLITR ME |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-28 | 8 | 145 | 15 | 156 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-28 | 8 | 145 | 15 | 156 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-28 | 8 | 145 | 15 | 156 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-28 | 8 | 145 | 15 | 156 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swm_B | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swm_C | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swm_D | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swp_A | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swp_B | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swp_C | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
3swp_D | 1e-28 | 8 | 145 | 18 | 159 | NAC domain-containing protein 19 |
4dul_A | 1e-28 | 8 | 145 | 15 | 156 | NAC domain-containing protein 19 |
4dul_B | 1e-28 | 8 | 145 | 15 | 156 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022874530.1 | 8e-79 | protein CUP-SHAPED COTYLEDON 3-like | ||||
Swissprot | O04017 | 2e-37 | NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2 | ||||
TrEMBL | A0A2G9HEI9 | 1e-77 | A0A2G9HEI9_9LAMI; Uncharacterized protein | ||||
STRING | EOX94424 | 6e-72 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1882 | 24 | 66 |