PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100157130061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 179aa    MW: 20779.2 Da    PI: 9.236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100157130061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431.1e-131861144
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                                  rg+WT eEd ll ++++ +G g+W++ a+  g++Rt+k+c++rw
  Ote100157130061|100157130061 18 RGPWTLEEDNLLTQYIASHGIGRWNSSAKSAGLRRTGKSCRLRW 61
                                  89****************************************** PP

2Myb_DNA-binding285.2e-0962822445
                                  HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding 24 WktIartmgkgRtlkqcksrwq 45
                                  W++Ia++++ gRt++++k++w+
  Ote100157130061|100157130061 62 WSKIAQHLP-GRTDNEIKNYWR 82
                                  *********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2111369IPR017930Myb domain
SuperFamilySSF466891.98E-181681IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-151661IPR009057Homeodomain-like
SMARTSM007174.4E-121787IPR001005SANT/Myb domain
PfamPF002499.5E-121861IPR001005SANT/Myb domain
CDDcd001673.46E-112082No hitNo description
Gene3DG3DSA:1.10.10.602.5E-106284IPR009057Homeodomain-like
PfamPF002497.4E-76283IPR001005SANT/Myb domain
PROSITE profilePS500904.176685IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MVSKGSSKLD GDGGELRRGP WTLEEDNLLT QYIASHGIGR WNSSAKSAGL RRTGKSCRLR  60
WWSKIAQHLP GRTDNEIKNY WRSRVQKQAR QLKLDSNSTK FQQVIRFHLM PTLLQKMEQQ  120
AISDQTPTLT PLQSNHSPDH NSTEFSFLDI PDLGCHQIST HDDWFHQTSF WNTDELWQF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070788.12e-52transcription factor MYB62
SwissprotQ10MB41e-45MYB2_ORYSJ; Transcription factor MYB2
TrEMBLA0A059PSU03e-64A0A059PSU0_SALMI; MYB-related transcription factor
STRINGXP_009626235.12e-50(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  3. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  4. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  5. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]