PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100157130061

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

MYB

Protein Properties

Length: 179aa MW: 20779.2 Da PI: 9.236

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100157130061	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43	1.1e-13	18	61	1	44
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 rg+WT eEd ll ++++ +G g+W++ a+ g++Rt+k+c++rw Ote100157130061\|100157130061 18 RGPWTLEEDNLLTQYIASHGIGRWNSSAKSAGLRRTGKSCRLRW 61 89****************************************** PP
2	Myb_DNA-binding	28	5.2e-09	62	82	24	45
HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 24 WktIartmgkgRtlkqcksrwq 45 W++Ia++++ gRt++++k++w+ Ote100157130061\|100157130061 62 WSKIAQHLP-GRTDNEIKNYWR 82 *******.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.211	13	69	IPR017930	Myb domain
SuperFamily	SSF46689	1.98E-18	16	81	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	4.1E-15	16	61	IPR009057	Homeodomain-like
SMART	SM00717	4.4E-12	17	87	IPR001005	SANT/Myb domain
Pfam	PF00249	9.5E-12	18	61	IPR001005	SANT/Myb domain
CDD	cd00167	3.46E-11	20	82	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.5E-10	62	84	IPR009057	Homeodomain-like
Pfam	PF00249	7.4E-7	62	83	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	4.17	66	85	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
MVSKGSSKLD GDGGELRRGP WTLEEDNLLT QYIASHGIGR WNSSAKSAGL RRTGKSCRLR 60 WWSKIAQHLP GRTDNEIKNY WRSRVQKQAR QLKLDSNSTK FQQVIRFHLM PTLLQKMEQQ 120 AISDQTPTLT PLQSNHSPDH NSTEFSFLDI PDLGCHQIST HDDWFHQTSF WNTDELWQF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011070788.1	2e-52	transcription factor MYB62
Swissprot	Q10MB4	1e-45	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A059PSU0	3e-64	A0A059PSU0_SALMI; MYB-related transcription factor
STRING	XP_009626235.1	2e-50	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1397	23	75

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]