PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100155790051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 555aa    MW: 61094.2 Da    PI: 6.2796
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100155790051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-183885148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Ote100155790051|100155790051 38 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 85
                                  79******************************************9986 PP

2Myb_DNA-binding33.31.1e-1091172146
                                   TSSS-HHHHHHHHHHHHHTTTT................................-HHHHHHHHT....TTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg................................tWktIartmg....kgRtlkqcksrwq 45 
                                   +g++T+eE+ +++++++++G++                                +++ +a+t       gRt++++k++w+
  Ote100155790051|100155790051  91 KGAFTPEEERRIIELHAKMGNKwarmaveevhflvlhfamleldkdrvfvelslRPTQVAQTRArldlPGRTDNEIKNYWN 171
                                   799***********************************************************9999999***********9 PP

                                   H CS
               Myb_DNA-binding  46 k 46 
                                   +
  Ote100155790051|100155790051 172 T 172
                                   6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.7713389IPR017930Myb domain
SMARTSM007171.7E-133787IPR001005SANT/Myb domain
PfamPF002494.3E-153885IPR001005SANT/Myb domain
SuperFamilySSF466893.1E-2439115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-243992IPR009057Homeodomain-like
CDDcd001675.44E-114085No hitNo description
PROSITE profilePS500907.54986174IPR017877Myb-like domain
SMARTSM007172.5E-690176IPR001005SANT/Myb domain
PfamPF002495.2E-691117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2093118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-20157177IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MRMSSESDER VKPNSGIDSP SADDAIEGNV VGNGPLKKGP WTSAEDAILV EYVTKHGEGN  60
WNAVQKHSGL ARCGKSCRLR WANHLRPDLK KGAFTPEEER RIIELHAKMG NKWARMAVEE  120
VHFLVLHFAM LELDKDRVFV ELSLRPTQVA QTRARLDLPG RTDNEIKNYW NTRIKRRQRA  180
GLPIYPPDIC MQSLNENLQS DNTNNFSSGD VHNPDVMPGS NFEIPPVEFK SLEFNHHMYN  240
TPALLDFPAG SLLDSPANSP LVQCLNSSYH NKSLHPTVHQ SKRLRVPDPL FPSLNAPICS  300
AFPGGNQYQS ECSTQIGKSS VFSAYDHNPA TDHARSRSLP NGSHAVLNGH PSSEPAWAMK  360
LELPSLQTQT GTWGSPSPSS PLPFYDSVDI LIQTPPNEQM QSCNLSSQNS GLLDAVLYES  420
ETLKNPKSNV SVQQTPNFSG AAVDTMDNSA HALNETKWRA YEEQLSPLGH SSSSLFSEST  480
PISGTSLDDP FSAGAFPDQI YCSPQTALIQ TNIQLHSLLK DAIGTVHDLS RECKKVDIGA  540
TPPAQAHDHE SVICI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25361775107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090254.10.0transcription factor GAMYB-like
TrEMBLA0A059PSR60.0A0A059PSR6_SALMI; MYB-related transcription factor
STRINGXP_009786742.11e-167(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358