PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100150970231 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 208aa MW: 23913.2 Da PI: 8.1815 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.2 | 1.4e-30 | 21 | 70 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs +g+lyey+ Ote100150970231|100150970231 21 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSGRGRLYEYA 70 79***********************************************8 PP | |||||||
2 | K-box | 68.9 | 1.6e-23 | 79 | 143 | 35 | 99 |
K-box 35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 R+llGe+L+++++keL+++e+++ek+++kiR k+nell+++i +qk+e elq++n++Lr+k++ Ote100150970231|100150970231 79 ERQLLGEGLSDMQVKELRNMESKVEKAISKIRGKQNELLFAEIGLMQKREVELQNANMYLRAKVQ 143 6*************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.7E-39 | 13 | 72 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.618 | 13 | 73 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.09E-30 | 14 | 81 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.93E-43 | 14 | 88 | No hit | No description |
PRINTS | PR00404 | 1.4E-32 | 15 | 35 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 15 | 69 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-26 | 22 | 69 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-32 | 35 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-32 | 50 | 71 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.004 | 58 | 148 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.8E-16 | 79 | 142 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MGFGNEESEL RKNGRGKIQI KRIENTTNRQ VTFCKRRNGL LKKAYELSVL CDAEVALVVF 60 SGRGRLYEYA NNSVRATIER QLLGEGLSDM QVKELRNMES KVEKAISKIR GKQNELLFAE 120 IGLMQKREVE LQNANMYLRA KVQIGESSRA EEEMKMMNNP SAASGWDYXX XXXXXXYDDD 180 DVRNFLPLNL LQPHHYSADQ DQTPLQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-19 | 14 | 74 | 2 | 62 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011082936.1 | 5e-88 | floral homeotic protein AGAMOUS | ||||
Swissprot | Q93XH4 | 9e-76 | MADS1_VITVI; Agamous-like MADS-box protein MADS1 | ||||
TrEMBL | A0A4D8XQR3 | 2e-89 | A0A4D8XQR3_SALSN; MADS-box transcription factor, plant | ||||
STRING | XP_009762632.1 | 2e-83 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Publications ? help Back to Top | |||
---|---|---|---|
|