PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100150970151 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 119aa MW: 13210.2 Da PI: 8.7292 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.8 | 4.5e-31 | 49 | 98 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs +g+lyey+ Ote100150970151|100150970151 49 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSGRGRLYEYA 98 79***********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.618 | 41 | 101 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.7E-39 | 41 | 100 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.23E-41 | 42 | 101 | No hit | No description |
SuperFamily | SSF55455 | 6.41E-30 | 42 | 104 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 43 | 97 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-33 | 43 | 63 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.5E-27 | 50 | 97 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-33 | 63 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-33 | 78 | 99 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
METNSQPQFT AVVSLELLAL LPLFLASWMG FGNEESELRK NGRGKIQIKR IENTTNRQVT 60 FCKRRNGLLK KAYELSVLCD AEVALVVFSG RGRLYEYANN SAASDVMLGH GLGFEGLNP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_R | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_S | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
3mu6_A | 9e-21 | 42 | 101 | 1 | 60 | Myocyte-specific enhancer factor 2A |
3mu6_B | 9e-21 | 42 | 101 | 1 | 60 | Myocyte-specific enhancer factor 2A |
3mu6_C | 9e-21 | 42 | 101 | 1 | 60 | Myocyte-specific enhancer factor 2A |
3mu6_D | 9e-21 | 42 | 101 | 1 | 60 | Myocyte-specific enhancer factor 2A |
6c9l_A | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_B | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_C | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_D | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_E | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_F | 9e-21 | 42 | 101 | 2 | 61 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011082936.1 | 2e-40 | floral homeotic protein AGAMOUS | ||||
Swissprot | Q01540 | 3e-38 | AG_BRANA; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A4D9B436 | 2e-39 | A0A4D9B436_SALSN; MADS-box transcription factor, plant | ||||
STRING | Cagra.9536s0004.1.p | 6e-37 | (Capsella grandiflora) | ||||
STRING | Bostr.30275s0374.1.p | 7e-37 | (Boechera stricta) | ||||
STRING | XP_006414034.1 | 2e-37 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |