PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100147780061 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 148aa MW: 16835.2 Da PI: 5.7286 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 72.5 | 3.5e-23 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien++n qvtfskRr g++KKA+E+ vLCd++ +i++s++g+l +s Ote100147780061|100147780061 9 KKIENTTNLQVTFSKRRYGLIKKAYEIAVLCDIDLTLIMLSPSGRLSHFS 58 78********************************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.6E-29 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.324 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.06E-23 | 2 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.3E-21 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-21 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-21 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MGRSKLPIKK IENTTNLQVT FSKRRYGLIK KAYEIAVLCD IDLTLIMLSP SGRLSHFSVE 60 DVIYRYINLS DRDRGGIIAN REQIVNTLAK IKTEKELAMQ SAATPGSDTE EIQKEIVDLQ 120 HQLEHAEYQL SVFEPDSDKF TSLAEFQS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6byy_A | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6byy_B | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6byy_C | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6byy_D | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6bz1_A | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6bz1_B | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6bz1_C | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6bz1_D | 4e-15 | 1 | 71 | 1 | 74 | MEF2 CHIMERA |
6c9l_A | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-15 | 1 | 71 | 1 | 74 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011097601.1 | 2e-86 | agamous-like MADS-box protein AGL66 | ||||
Swissprot | Q9LM46 | 2e-44 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | A0A4D9AL80 | 5e-84 | A0A4D9AL80_SALSN; Uncharacterized protein | ||||
STRING | XP_010269101.1 | 3e-57 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6183 | 19 | 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|