PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100135980071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 381aa    MW: 42561.3 Da    PI: 7.5868
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100135980071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS110.12.9e-349118947152
                          GRAS  47 eALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpa 127
                                   eAL+  l++     ++a ++s+    + + ++ a+k fse+sP+++f+++t+NqaIle veg +r+Hi+Dfdi++G+QW++
  Ote100135980071|100135980071  91 EALQLLLHN----NSSAPTSSP---FSLVFKIGAYKSFSEISPLVQFANFTCNQAILEVVEGFDRIHIVDFDIGYGGQWAS 164
                                   677777766....222223333...3499**************************************************** PP

                          GRAS 128 LlqaLasRpegppslRiTgvgspes 152
                                   L+q+La R +g+psl+iT+++s ++
  Ote100135980071|100135980071 165 LMQELALRGGGTPSLKITALASTST 189
                                   ********************99654 PP

2GRAS1326.7e-41214380199374
                          GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                                   +E++aV + l + +l  +++ ++     +L++vk+lsP++vv v++ +d+++ +F++++++al+ ys l++sl+a    + 
  Ote100135980071|100135980071 214 QENVAVAVNLPVGSLAYHQLLVPL----ILRFVKQLSPRIVVSVDRGCDRTDLPFANHVVHALQSYSNLLESLDAV-NVNM 289
                                   677777777777777655555555....*********************************************665.4577 PP

                          GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                                   ++ +k+Er+ll++ i+++v+ + ++     e+ ++Wr+ + ++GF+p+++s+++++qa++++++++++g++ve+++ slvl
  Ote100135980071|100135980071 290 DALQKIERFLLQPGIEKIVMGRVRS----PEKTQHWRALFLSSGFTPLTFSNFTESQAECVIKRTPVRGFQVEKRQSSLVL 366
                                   999*****************98887....9*************************************************** PP

                          GRAS 361 gWkdrpLvsvSaWr 374
                                   +W++++L+s++aWr
  Ote100135980071|100135980071 367 CWQRKELISATAWR 380
                                   *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098522.7031360IPR005202Transcription factor GRAS
PfamPF035141.0E-3191189IPR005202Transcription factor GRAS
PfamPF035142.3E-38214380IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEDWESVLSE SAAVSPSQEQ AFLRWVMGDV EDPAMGNLNK QLPGLPHQLQ LLPHFRPMGQ  60
KPKVDDCHQQ QQAIVDQLYK SAELVQTGNP EALQLLLHNN SSAPTSSPFS LVFKIGAYKS  120
FSEISPLVQF ANFTCNQAIL EVVEGFDRIH IVDFDIGYGG QWASLMQELA LRGGGTPSLK  180
ITALASTSTX XXXXXXXXXX XXXRPHSRKP NSAQENVAVA VNLPVGSLAY HQLLVPLILR  240
FVKQLSPRIV VSVDRGCDRT DLPFANHVVH ALQSYSNLLE SLDAVNVNMD ALQKIERFLL  300
QPGIEKIVMG RVRSPEKTQH WRALFLSSGF TPLTFSNFTE SQAECVIKRT PVRGFQVEKR  360
QSSLVLCWQR KELISATAWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-2511838080375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090295.11e-167scarecrow-like protein 6
SwissprotO813161e-107SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A2G9GWL51e-177A0A2G9GWL5_9LAMI; Uncharacterized protein
TrEMBLA0A4D8ZRK61e-178A0A4D8ZRK6_SALSN; Uncharacterized protein
STRINGPGSC0003DMT4000667991e-161(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]