PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100119120101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 227aa    MW: 26105.5 Da    PI: 6.404
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100119120101genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding315.9e-102367345
                                  SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                                  +W+ +Ed+++ +a  +++ g   +W++Ia++++ g+++ ++  ++ 
  Ote100119120101|100119120101 23 SWSRQEDKIFEKALVEFPEGvgdRWHKIAEYLP-GKSPDEVEAHYE 67
                                  6********************************.********9996 PP

2Myb_DNA-binding43.76.2e-14132176347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Ote100119120101|100119120101 132 PWTEDEHRLFLIGLERYGKGDWRSISRNVVVTRTPTQVASHAQKY 176
                                   8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.7071976IPR017884SANT domain
SMARTSM007174.0E-92072IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-62270IPR009057Homeodomain-like
CDDcd001673.46E-92370No hitNo description
PfamPF002495.6E-92367IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-102376IPR009057Homeodomain-like
PROSITE profilePS5129419.521125181IPR017930Myb domain
SuperFamilySSF466892.15E-16127181IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17128179IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-11129175IPR009057Homeodomain-like
SMARTSM007171.2E-10129179IPR001005SANT/Myb domain
CDDcd001673.21E-9132177No hitNo description
PfamPF002496.5E-12132176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MNFFETMYSI DENECLMRCA AVSWSRQEDK IFEKALVEFP EGVGDRWHKI AEYLPGKSPD  60
EVEAHYEALL YDITEIDSGR VELPSYSDLS XXXXXXXWEN DRVRSRTPGQ ISFGSPGNRS  120
RHLDAERKKG TPWTEDEHRL FLIGLERYGK GDWRSISRNV VVTRTPTQVA SHAQKYFLRH  180
TSGKKERKRS SIHDITTAMD SLTVPPPAPT SLPNQGAFQD FNFSMPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-131886573RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084236.11e-111transcription factor SRM1-like
SwissprotQ9FNN62e-54SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A4D8ZA531e-128A0A4D8ZA53_SALSN; Uncharacterized protein
STRINGMigut.F01593.1.p8e-97(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]