PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100116840161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB_related
Protein Properties Length: 415aa    MW: 46854.3 Da    PI: 6.2965
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100116840161genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.3e-17233275145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   ++ W+++Ed +l++a++q G++ W+ Ia+ ++ gRt++ +k++w+
  Ote100116840161|100116840161 233 KDVWSEDEDRILIEAHAQVGNK-WAEIAKSLP-GRTENTIKNHWN 275
                                   578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.437188227IPR017930Myb domain
SMARTSM007170.0012192229IPR001005SANT/Myb domain
CDDcd001673.35E-8196227No hitNo description
Gene3DG3DSA:1.10.10.606.8E-16200234IPR009057Homeodomain-like
PfamPF002492.4E-6203227IPR001005SANT/Myb domain
SuperFamilySSF466893.99E-27207285IPR009057Homeodomain-like
PROSITE profilePS5129424.847228282IPR017930Myb domain
SMARTSM007173.1E-16232280IPR001005SANT/Myb domain
PfamPF002493.5E-15233275IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-21235281IPR009057Homeodomain-like
CDDcd001679.53E-13236278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MEPSTNNCIA ISLPTGFSNI NLKQEILDDD FGLDNLSSLK GFLQDFQDME KFPPPTSFLN  60
CSTGIQANGF DAYTSFSNGC FTDFGLNRYK PSEENGGVVL AMQDFQAGGF LNFSDMKDSS  120
MMTKTASEYH GPKPLSVVVP DVSSCVTGDN FGYHNEEGRK RSKNIVHNNK NNVRGSLSTK  180
KFVRGPKKSK SAKGQWTAEE DRKWSNIAQM LKGRIGKQCR ERWHNHLRPD IKKDVWSEDE  240
DRILIEAHAQ VGNKWAEIAK SLPGRTENTI KNHWNATKRR QFTRRKCRTK WPRPSSLLQN  300
YIKSLNFEKD NSNTSKKVQT PTTTDHGVVS NSSISAPPEL NMDFSTDDHH MVQEYGFDEV  360
QDLIFDDDHL LSGSSINAFM DDMPVGLPSE INGEESFDVE LPFDMSPLMQ CDYAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-391932814104C-Myb DNA-Binding Domain
1msf_C1e-391932814104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101317.11e-134transcription factor MYB98-like
TrEMBLA0A059PRP60.0A0A059PRP6_SALMI; MYB-related transcription factor
STRINGMigut.D01939.1.p1e-116(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349