PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100090230021 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 118aa MW: 13574 Da PI: 5.8175 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 59.7 | 6.7e-19 | 15 | 67 | 2 | 56 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 +y+GVr + +g+++AeIrd s +g +r++lg+f taeeAa+a+++a+ +++g+ Ote100090230021|100090230021 15 KYRGVRKRQ-WGKYAAEIRDTSRQG-AARVWLGTFKTAEEAARAYDRAAYQMRGH 67 8*****888.**********43333.5**************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51032 | 22.958 | 15 | 74 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 4.32E-21 | 15 | 75 | IPR016177 | DNA-binding domain |
SMART | SM00380 | 1.5E-30 | 15 | 80 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 1.2E-13 | 15 | 67 | IPR001471 | AP2/ERF domain |
Gene3D | G3DSA:3.30.730.10 | 1.4E-29 | 15 | 76 | IPR001471 | AP2/ERF domain |
CDD | cd00018 | 1.99E-17 | 15 | 75 | No hit | No description |
PRINTS | PR00367 | 3.0E-11 | 16 | 27 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 3.0E-11 | 40 | 56 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MEESGSRKGD GGEVKYRGVR KRQWGKYAAE IRDTSRQGAA RVWLGTFKTA EEAARAYDRA 60 AYQMRGHLAI LNFPEEYNMP SSSSHFAAPS STERQVIEFE YYDDKLLEEL LDDNKRDN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5wx9_A | 7e-33 | 15 | 106 | 14 | 114 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025886110.1 | 2e-48 | ethylene-responsive transcription factor ERF098-like | ||||
Swissprot | Q9LTC5 | 1e-37 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | A0A2G9I9T0 | 2e-56 | A0A2G9I9T0_9LAMI; Uncharacterized protein | ||||
STRING | Solyc03g005500.1.1 | 8e-48 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA21 | 24 | 1165 |
Publications ? help Back to Top | |||
---|---|---|---|
|