PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100081660001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB_related
Protein Properties Length: 80aa    MW: 9198.45 Da    PI: 8.7994
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100081660001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.68.2e-201257147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + 
  Ote100081660001|100081660001 12 KGPWSPEEDESLQRLVEKFGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                                  79******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.854762IPR017930Myb domain
SuperFamilySSF466891.1E-21879IPR009057Homeodomain-like
SMARTSM007171.7E-161160IPR001005SANT/Myb domain
PfamPF002491.2E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-231257IPR009057Homeodomain-like
CDDcd001673.56E-151456No hitNo description
Gene3DG3DSA:1.10.10.602.3E-55880IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MAGHKKEMDR IKGPWSPEED ESLQRLVEKF GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDDAIIKAHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-221179371C-Myb DNA-Binding Domain
1msf_C5e-221179371C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611666.27e-46transcription factor MYB44
SwissprotO231604e-41MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A396HN332e-44A0A396HN33_MEDTR; Putative transcription factor MYB-HB-like family
TrEMBLB7FK683e-45B7FK68_MEDTR; Uncharacterized protein
TrEMBLI3T3V22e-44I3T3V2_MEDTR; Uncharacterized protein
STRINGXP_008360495.13e-45(Malus domestica)
STRINGEMJ067218e-45(Prunus persica)
STRINGXP_007155887.14e-45(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]