![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100081660001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 80aa MW: 9198.45 Da PI: 8.7994 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.6 | 8.2e-20 | 12 | 57 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + Ote100081660001|100081660001 12 KGPWSPEEDESLQRLVEKFGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57 79******************************.***********985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.854 | 7 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.1E-21 | 8 | 79 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-16 | 11 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-19 | 12 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-23 | 12 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.56E-15 | 14 | 56 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-5 | 58 | 80 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MAGHKKEMDR IKGPWSPEED ESLQRLVEKF GPRNWSLISK SIPGRSGKSC RLRWCNQLSP 60 QVEHRAFTPE EDDAIIKAHA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 5e-22 | 11 | 79 | 3 | 71 | C-Myb DNA-Binding Domain |
1msf_C | 5e-22 | 11 | 79 | 3 | 71 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003611666.2 | 7e-46 | transcription factor MYB44 | ||||
Swissprot | O23160 | 4e-41 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A396HN33 | 2e-44 | A0A396HN33_MEDTR; Putative transcription factor MYB-HB-like family | ||||
TrEMBL | B7FK68 | 3e-45 | B7FK68_MEDTR; Uncharacterized protein | ||||
TrEMBL | I3T3V2 | 2e-44 | I3T3V2_MEDTR; Uncharacterized protein | ||||
STRING | XP_008360495.1 | 3e-45 | (Malus domestica) | ||||
STRING | EMJ06721 | 8e-45 | (Prunus persica) | ||||
STRING | XP_007155887.1 | 4e-45 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1586 | 24 | 71 |
Publications ? help Back to Top | |||
---|---|---|---|
|