PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100054340031 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 92aa MW: 11476.3 Da PI: 9.8692 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.4 | 1.8e-09 | 32 | 71 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+++ +k+ G + W++Ia +++ gR ++++ +w+ Ote100054340031|100054340031 32 MTEQEEDLIYRMHKLVGDK-WALIAGRVP-GRKAEEIERFWL 71 7****************99.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 5.5E-7 | 28 | 76 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.11E-5 | 31 | 72 | No hit | No description |
Pfam | PF00249 | 6.0E-9 | 32 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-11 | 32 | 71 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.33E-7 | 33 | 72 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MDKFCRQKKH PKIRKYPLCE EVSSIEWEFI NMTEQEEDLI YRMHKLVGDK WALIAGRVPG 60 RKAEEIERFW LMRNSENFKD KRREYYYNRK KS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020553647.1 | 5e-38 | MYB-like transcription factor ETC3 | ||||
Swissprot | Q8GV05 | 3e-35 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A4D9ATA4 | 3e-48 | A0A4D9ATA4_SALSN; Myb proto-oncogene protein, plant | ||||
STRING | XP_006491245.1 | 3e-35 | (Citrus sinensis) | ||||
STRING | XP_006444875.1 | 3e-35 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11707 | 18 | 24 |