PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100049890041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 381aa    MW: 43951.2 Da    PI: 6.6421
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100049890041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-19180226148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g WT+eEd+ll+++v+++G + W++Ia+ +  gR +kqc++rw+++l
  Ote100049890041|100049890041 180 KGQWTAEEDKLLIHLVEKHGEKKWSKIAQLVK-GRIGKQCRERWHNHL 226
                                   799****************************9.*************97 PP

2Myb_DNA-binding54.13.7e-17232274145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   ++ WT+eEd  l++++ ++G++ W+ Ia++++ gRt++++k++w+
  Ote100049890041|100049890041 232 KDVWTEEEDRVLIEGHVEMGNK-WAEIAKRLP-GRTENSIKNHWN 274
                                   578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.536175230IPR017930Myb domain
SMARTSM007176.1E-18179228IPR001005SANT/Myb domain
SuperFamilySSF466899.71E-32180273IPR009057Homeodomain-like
PfamPF002491.5E-18180226IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-28181234IPR009057Homeodomain-like
CDDcd001671.90E-16183226No hitNo description
SMARTSM007174.1E-17231279IPR001005SANT/Myb domain
PROSITE profilePS5129422.583231281IPR017930Myb domain
PfamPF002491.5E-15232274IPR001005SANT/Myb domain
CDDcd001674.83E-13235277No hitNo description
Gene3DG3DSA:1.10.10.601.6E-22235281IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEPETKYGNV HGAPPLPLGQ TNNGLKFQAL DDDFCIDNFS SPLRKTYLQD FHQLDQLPLI  60
KPSPFNPDID TQLSVFDPFF HGFDLYEDTK PYDHGNGNGI AFSAMKSFHN CDGILNSTNR  120
KDLFMEIDTT SIAHDPNPFS ILVPDESSCV TEDHFHRETN SVKRGTASTK KGRRKAKSGK  180
GQWTAEEDKL LIHLVEKHGE KKWSKIAQLV KGRIGKQCRE RWHNHLRPDI KKDVWTEEED  240
RVLIEGHVEM GNKWAEIAKR LPGRTENSIK NHWNATKRRQ LSRRKCRTKW PRPTSLLQNY  300
IKSLTTAEKE KNTTTTLRNA DVSDVHFSPS DNMVHDYEIH DDVPDFSFMD QDEPCFHLEF  360
PFDAPPLMQH EVKEELDFSV G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-431802814105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-4318028158159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-4318028158159MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-441802814105C-Myb DNA-Binding Domain
1msf_C9e-441802814105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101317.11e-113transcription factor MYB98-like
TrEMBLA0A059PRU11e-137A0A059PRU1_SALMI; MYB-related transcription factor
STRINGMigut.D01939.1.p1e-112(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349