PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100038860061 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 211aa MW: 24108.2 Da PI: 6.5202 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 118.3 | 7.3e-37 | 13 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lppGfrF+Ptdee+v +yL +k+ +++l++ i+e+d++ ++Pw+Lp v +e+++yfF ++++ + r rat+sg Ote100038860061|100038860061 13 LPPGFRFRPTDEEIVFQYLSRKTFSHPLPA-LLIPEFDVFAFDPWELP-GVGDGEQDMYFFYNKENG--RALRYGRATDSG 89 79*************************999.67***************.677889999***998875..568********* PP NAM 82 yWkatgkdkevlskkgel.vglkktLvfykg.rapkgektdWvmheyrl 128 +Wkatg++k+++++k+ vg+++ ++fy+g ++ ++ +tdW+mhey + Ote100038860061|100038860061 90 FWKATGTSKRIICSKEIPiVGIRRAFAFYRGaKHDRAIRTDWIMHEYYI 138 *********99996444359*********996778899*********75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.14E-44 | 5 | 167 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.595 | 13 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.2E-21 | 14 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MEKLNFARGG SKLPPGFRFR PTDEEIVFQY LSRKTFSHPL PALLIPEFDV FAFDPWELPG 60 VGDGEQDMYF FYNKENGRAL RYGRATDSGF WKATGTSKRI ICSKEIPIVG IRRAFAFYRG 120 AKHDRAIRTD WIMHEYYITL SENPHNDNSE GCLIRIGKWT LCRIFLKNRM RATAVGDDFL 180 TETDMDTSDS YTSSASSSTS DSGIFDEVSS M |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-32 | 13 | 168 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-32 | 13 | 168 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-32 | 13 | 168 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-32 | 13 | 168 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 2e-32 | 13 | 168 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 2e-32 | 13 | 168 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 2e-32 | 13 | 168 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011083447.1 | 3e-71 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 4e-45 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2G9HP54 | 4e-68 | A0A2G9HP54_9LAMI; Uncharacterized protein | ||||
STRING | Migut.D01296.1.p | 3e-64 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|