PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100037300001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 90aa MW: 9630.73 Da PI: 7.3726 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 102 | 3.9e-32 | 37 | 89 | 3 | 56 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 ++ Y+eClkNhAa++Gg+++DGCgEfmps g++gt +alkCaAC CHRnFHRr+ Ote100037300001|100037300001 37 RISYRECLKNHAANIGGNVTDGCGEFMPS-GDDGTLEALKCAACSCHRNFHRRD 89 689*************************9.999*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 8.0E-21 | 34 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.9E-29 | 38 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 8.1E-30 | 40 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.241 | 40 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MSLPGEEKEI RVQPAGCNNI SSDPYSGGSK PKPAAPRISY RECLKNHAAN IGGNVTDGCG 60 EFMPSGDDGT LEALKCAACS CHRNFHRRDH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21779177}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269|PubMed:21779177}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012846086.1 | 7e-40 | PREDICTED: zinc-finger homeodomain protein 5 | ||||
Swissprot | Q9FRL5 | 4e-26 | ZHD5_ARATH; Zinc-finger homeodomain protein 5 | ||||
TrEMBL | A0A2G9H6D1 | 5e-42 | A0A2G9H6D1_9LAMI; Uncharacterized protein | ||||
STRING | Migut.C00746.1.p | 3e-39 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |