PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100034290001

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

HSF

Protein Properties

Length: 94aa MW: 10974.4 Da PI: 7.6811

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100034290001	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	86.9	2.7e-27	21	79	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d++++++isw+++g++f+v+++ efa+++LpkyFkh+nf+SFvRQLn+Y Ote100034290001\|100034290001 21 FLTKTYQLVDDHSVDDVISWNADGTTFIVWNQAEFARDLLPKYFKHNNFSSFVRQLNTY 79 9********************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	4.4E-28	15	80	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	7.8E-27	17	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	2.38E-24	18	80	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.4E-16	21	44	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	6.2E-23	21	80	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-16	59	71	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-16	72	84	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MERKGGESYG EDMPRLVPTP FLTKTYQLVD DHSVDDVISW NADGTTFIVW NQAEFARDLL 60 PKYFKHNNFS SFVRQLNTYV INPSISARLT LRFR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	3e-19	10	79	19	87	Heat shock factor protein 1
5d5v_B	3e-19	10	79	19	87	Heat shock factor protein 1
5d5v_D	3e-19	10	79	19	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011076201.1	1e-40	heat stress transcription factor B-2a
Refseq	XP_011076202.1	1e-40	heat stress transcription factor B-2a
Refseq	XP_028108220.1	5e-41	heat stress transcription factor B-2a
Swissprot	Q6Z9C8	2e-35	HFB2B_ORYSJ; Heat stress transcription factor B-2b
TrEMBL	A0A2Z4K5C0	4e-42	A0A2Z4K5C0_TECGR; HSF2 protein
STRING	Migut.F00357.1.p	7e-40	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Xiang J, et al. Heat shock factor OsHsfB2b negatively regulates drought and salt tolerance in rice. Plant Cell Rep., 2013. 32(11): p. 1795-806 [PMID:23949687]