![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100033380061 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 91aa MW: 10951.4 Da PI: 10.6413 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.6 | 7e-19 | 9 | 54 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+++G+ +W++Ia++++ gR++k+c++rw++ Ote100033380061|100033380061 9 RGHWRPAEDEKLRRLVEKYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 54 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 35 | 3.3e-11 | 61 | 91 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 r ++++eE+e+l+ a++++G++ W++I+r ++ Ote100033380061|100033380061 61 RRPFSEEEEERLLAAHRMHGNK-WALISRLFP 91 679*******************.******987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.729 | 1 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.24E-25 | 8 | 91 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.5E-15 | 8 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-18 | 9 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-27 | 10 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.86E-14 | 12 | 53 | No hit | No description |
SMART | SM00717 | 1.9 | 60 | 91 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 13.165 | 61 | 91 | IPR017930 | Myb domain |
Pfam | PF00249 | 9.9E-9 | 61 | 91 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-9 | 68 | 90 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MDDPRTSPRG HWRPAEDEKL RRLVEKYGPQ NWNSIAEKLQ GRSGKSCRLR WFNQLDPRID 60 RRPFSEEEEE RLLAAHRMHG NKWALISRLF P |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-22 | 9 | 91 | 4 | 86 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-22 | 9 | 91 | 4 | 86 | C-Myb DNA-Binding Domain |
1msf_C | 1e-22 | 9 | 91 | 4 | 86 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022869123.1 | 8e-56 | transcription factor LAF1-like | ||||
Refseq | XP_022869124.1 | 8e-56 | transcription factor LAF1-like | ||||
Swissprot | Q5NBM8 | 5e-46 | CSA_ORYSJ; Transcription factor CSA | ||||
Swissprot | Q6R0C4 | 1e-46 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A2R6Q2F6 | 8e-55 | A0A2R6Q2F6_ACTCH; Transcription factor like | ||||
STRING | XP_009769218.1 | 7e-53 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1784 | 24 | 66 |