PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100033380061
Organism
Ocimum tenuiflorum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 91aa    MW: 10951.4 Da    PI: 10.6413
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100033380061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.67e-19954147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  rg W + Ede+l ++v+++G+ +W++Ia++++ gR++k+c++rw++ 
  Ote100033380061|100033380061  9 RGHWRPAEDEKLRRLVEKYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 54
                                  899*****************************.***********996 PP
2Myb_DNA-binding353.3e-116191132
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                                  r ++++eE+e+l+ a++++G++ W++I+r ++
  Ote100033380061|100033380061 61 RRPFSEEEEERLLAAHRMHGNK-WALISRLFP 91
                                  679*******************.******987 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.729159IPR017930Myb domain
SuperFamilySSF466898.24E-25891IPR009057Homeodomain-like
SMARTSM007173.5E-15857IPR001005SANT/Myb domain
PfamPF002491.6E-18955IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-271067IPR009057Homeodomain-like
CDDcd001679.86E-141253No hitNo description
SMARTSM007171.96091IPR001005SANT/Myb domain
PROSITE profilePS5129413.1656191IPR017930Myb domain
PfamPF002499.9E-96191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-96890IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MDDPRTSPRG HWRPAEDEKL RRLVEKYGPQ NWNSIAEKLQ GRSGKSCRLR WFNQLDPRID  60
RRPFSEEEEE RLLAAHRMHG NKWALISRLF P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-22991486MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-22991486C-Myb DNA-Binding Domain
1msf_C1e-22991486C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}.
UniProtTranscription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}.
UniProtINDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022869123.18e-56transcription factor LAF1-like
RefseqXP_022869124.18e-56transcription factor LAF1-like
SwissprotQ5NBM85e-46CSA_ORYSJ; Transcription factor CSA
SwissprotQ6R0C41e-46MYB52_ARATH; Transcription factor MYB52
TrEMBLA0A2R6Q2F68e-55A0A2R6Q2F6_ACTCH; Transcription factor like
STRINGXP_009769218.17e-53(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Publications ? help Back to Top
  1. Leonard LM,Follette VM
    Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications.
    Annu Rev Sex Res, 2002. 13: p. 346-88
    [PMID:12836736]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Wang L,Li X,Chen Z
    Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities.
    Int. J. Biol. Macromol., 2009. 44(2): p. 211-4
    [PMID:19135473]
  4. Wang L,Huang H,Wei Y,Li X,Chen Z
    Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran.
    Int. J. Biol. Macromol., 2009. 45(4): p. 427-31
    [PMID:19549538]
  5. Zhang H, et al.
    Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development.
    Plant Cell, 2010. 22(3): p. 672-89
    [PMID:20305120]
  6. Zhang H, et al.
    Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81
    [PMID:23256151]
  7. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  8. Zhu X, et al.
    Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein.
    Plant J., 2015. 82(4): p. 570-81
    [PMID:25754973]
  9. Li X, et al.
    Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress.
    Plant Cell Environ., 2015. 38(10): p. 2171-92
    [PMID:25828772]
  10. Shaar-Moshe L,Hübner S,Peleg Z
    Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
    BMC Plant Biol., 2015. 15: p. 111
    [PMID:25935420]
  11. Shi D, et al.
    MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage.
    Plant Physiol., 2018. 176(4): p. 2737-2749
    [PMID:29440562]