PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100024130021 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 62aa MW: 6954.22 Da PI: 11.3251 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91 | 6.1e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n + rqvtfskRrng+lKKA+EL +LCda+va+iifsstgkly++++ Ote100024130021|100024130021 10 RIDNVTSRQVTFSKRRNGLLKKAKELAILCDADVALIIFSSTGKLYDFAT 59 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.413 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.9E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.19E-28 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.41E-37 | 2 | 60 | No hit | No description |
PRINTS | PR00404 | 3.8E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MGRGKIVIRR IDNVTSRQVT FSKRRNGLLK KAKELAILCD ADVALIIFSS TGKLYDFATT 60 PR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 1e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 1e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 1e-19 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. | |||||
UniProt | Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_026433223.1 | 7e-34 | MADS-box transcription factor 27-like isoform X6 | ||||
Swissprot | A2RVQ5 | 2e-29 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
Swissprot | Q6Z6W2 | 2e-29 | MAD57_ORYSJ; MADS-box transcription factor 57 | ||||
TrEMBL | A0A4D8YDP7 | 2e-31 | A0A4D8YDP7_SALSN; MADS-box transcription factor, plant | ||||
STRING | EOY15523 | 5e-32 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Publications ? help Back to Top | |||
---|---|---|---|
|