PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100022770061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 352aa    MW: 41092.6 Da    PI: 6.935
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100022770061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-17173220148
                                   TSSS-H.HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTt.eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g WT+ eEde lv++v+++G + W++Ia++++ gR +kqc++rw+++l
  Ote100022770061|100022770061 173 KGQWTPxEEDEVLVELVEKHGVRKWSSIAQMLP-GRIGKQCRERWHNHL 220
                                   688997699************************.*************97 PP

2Myb_DNA-binding56.94.8e-18226268145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   ++rW++eEd++l++a+++ G++ W+ Iar ++ gR+++ +k++w+
  Ote100022770061|100022770061 226 KDRWSEEEDQILIEAHQRVGNR-WAEIARSLP-GRSENTIKNHWN 268
                                   68********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.412168224IPR017930Myb domain
SuperFamilySSF466893.45E-30171267IPR009057Homeodomain-like
SMARTSM007177.9E-15172222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-24174224IPR009057Homeodomain-like
CDDcd001678.53E-15176220No hitNo description
PfamPF139215.0E-17179235No hitNo description
Gene3DG3DSA:1.10.10.606.0E-22225275IPR009057Homeodomain-like
PROSITE profilePS5129421.257225275IPR017930Myb domain
SMARTSM007171.1E-16225273IPR001005SANT/Myb domain
CDDcd001673.23E-12228271No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDLEAIQREN LALYTKIFDE TPYLPKMDEG FNTASSSSSS SNRVFTNNFD YSTADGSLNS  60
LCFPSFQDPF DPFLVRFNQE VSTFGNDAAQ NSYMHGSNSH SRRFLDGAAP FQTLDHHHQF  120
QTKHQFEYDY NLENSSNIPY MKTIDDDENH KGSNGKAQNK RKRIVDKNSE VIKGQWTPXE  180
EDEVLVELVE KHGVRKWSSI AQMLPGRIGK QCRERWHNHL KPNIKKDRWS EEEDQILIEA  240
HQRVGNRWAE IARSLPGRSE NTIKNHWNAT KRRQLSTRKN SNSTTPLQTY IRNLIXXXXX  300
XXXXXXXXXX XXXXGHDSFK QQQTTSLESH MHVQFDIQKE MDFMEMLSYG YI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-4416827553159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-4416827553159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554551.13e-93LOW QUALITY PROTEIN: uncharacterized protein LOC105177335
TrEMBLA0A059PRW01e-141A0A059PRW0_SALMI; MYB-related transcription factor
STRINGMigut.H00097.1.p2e-87(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349