PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100021120051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB_related
Protein Properties Length: 121aa    MW: 13435 Da    PI: 7.5629
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100021120051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.5e-193885148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Ote100021120051|100021120051 38 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 85
                                  79******************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.9023389IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-233684IPR009057Homeodomain-like
SMARTSM007171.7E-133787IPR001005SANT/Myb domain
PfamPF002493.4E-163885IPR001005SANT/Myb domain
SuperFamilySSF466895.72E-2239108IPR009057Homeodomain-like
CDDcd001671.14E-114085No hitNo description
Gene3DG3DSA:1.10.10.602.0E-785108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MRMSSERDER TKPDNFVDSP STDDVTEGNV GGNGLLKKGP WTSAEDAILV EYVTKHGEGN  60
WNAVQKHSGL ARCGKSCRLR WANHLRPDLK KGAFTPEEER HIIELHAXXX XNGKQMGSNG  120
C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-1736106574B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080497.13e-55transcription factor GAMYB-like isoform X1
RefseqXP_011080498.13e-55transcription factor GAMYB-like isoform X2
RefseqXP_011080499.13e-55transcription factor GAMYB-like isoform X2
RefseqXP_020549969.13e-55transcription factor GAMYB-like isoform X2
SwissprotA2WW871e-41GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A059PSR62e-61A0A059PSR6_SALMI; MYB-related transcription factor
STRINGMigut.N02411.1.p6e-52(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358