![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100021120051 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 121aa MW: 13435 Da PI: 7.5629 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.5 | 7.5e-19 | 38 | 85 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l Ote100021120051|100021120051 38 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 85 79******************************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.902 | 33 | 89 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-23 | 36 | 84 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-13 | 37 | 87 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-16 | 38 | 85 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.72E-22 | 39 | 108 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.14E-11 | 40 | 85 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-7 | 85 | 108 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MRMSSERDER TKPDNFVDSP STDDVTEGNV GGNGLLKKGP WTSAEDAILV EYVTKHGEGN 60 WNAVQKHSGL ARCGKSCRLR WANHLRPDLK KGAFTPEEER HIIELHAXXX XNGKQMGSNG 120 C |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-17 | 36 | 106 | 5 | 74 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011080497.1 | 3e-55 | transcription factor GAMYB-like isoform X1 | ||||
Refseq | XP_011080498.1 | 3e-55 | transcription factor GAMYB-like isoform X2 | ||||
Refseq | XP_011080499.1 | 3e-55 | transcription factor GAMYB-like isoform X2 | ||||
Refseq | XP_020549969.1 | 3e-55 | transcription factor GAMYB-like isoform X2 | ||||
Swissprot | A2WW87 | 1e-41 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | A0A059PSR6 | 2e-61 | A0A059PSR6_SALMI; MYB-related transcription factor | ||||
STRING | Migut.N02411.1.p | 6e-52 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2021 | 23 | 58 |