PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100012231181

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 7065.21 Da PI: 10.4603

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100012231181	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.8	1.2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++yey++ Ote100012231181\|100012231181 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYAN 59 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.4E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.908	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.29E-38	2	60	No hit	No description
SuperFamily	SSF55455	1.23E-30	2	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.8E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.1E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.8E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.8E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEYANN 60 K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	4e-22	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269\|PubMed:11828031, ECO:0000269\|PubMed:16326928, ECO:0000269\|PubMed:9869408}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022852794.1	8e-37	agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_022852795.1	8e-37	agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_022852796.1	8e-37	agamous-like MADS-box protein AGL11 isoform X3
Swissprot	Q40704	4e-36	MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBL	A0A124S2B0	2e-35	A0A124S2B0_CYNCS; Transcription factor, MADS-box
STRING	Migut.C01334.1.p	1e-35	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Publications ? help Back to Top
Kyozuka J,Shimamoto K Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants. Plant Cell Physiol., 2002. 43(1): p. 130-5 [PMID:11828031] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]