PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100008140071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 321aa    MW: 35429.3 Da    PI: 6.2318
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100008140071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS183.41.6e-56272043185
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   + L+++Ae +++g+ +laq +Larl+++ sp gdp+qR+a+y +eAL+  l++      ++ p+s+ s+ + + ++ a+k 
  Ote100008140071|100008140071  27 DHLFKAAELLQTGNPSLAQGILARLNHHLSPIGDPFQRAAFYCKEALQLLLHN-----NNTTPVSDLSPLSLVLKIGAYKS 102
                                   689**************************************************.....77788888888889********* PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetger 164
                                   fsevsPi+ f+++t+Nqa+lea+eg +r+Hi+Dfdi++G+QW++L+q+La R++g p lRiT+++sp++++  el+ t+e+
  Ote100008140071|100008140071 103 FSEVSPIIDFANFTCNQALLEALEGFDRIHIVDFDIGYGGQWASLMQELALRNGGGPALRITALVSPATHNPLELSLTREN 183
                                   ********************************************************************************* PP

                          GRAS 165 LakfAeelgvpfefnvlvakr 185
                                   L ++A+e+++ +e +++ +++
  Ote100008140071|100008140071 184 LIQYANEINIGLELDFMSTDS 204
                                   *************99975444 PP

2GRAS24.72.6e-08285321339374
                          GRAS 339 lllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   l+l++ +   g+ ve+++ slvl+W++++L+s+S+Wr
  Ote100008140071|100008140071 285 LVLHRNGsIGGFGVEKKQSSLVLCWQRKELLSASVWR 321
                                   56667776789*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.1771321IPR005202Transcription factor GRAS
PfamPF035145.4E-5427204IPR005202Transcription factor GRAS
PfamPF035149.1E-6285321IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MQLLPNHPHL QGLKTSGGDE LPQLIMDHLF KAAELLQTGN PSLAQGILAR LNHHLSPIGD  60
PFQRAAFYCK EALQLLLHNN NTTPVSDLSP LSLVLKIGAY KSFSEVSPII DFANFTCNQA  120
LLEALEGFDR IHIVDFDIGY GGQWASLMQE LALRNGGGPA LRITALVSPA THNPLELSLT  180
RENLIQYANE INIGLELDFM STDSLRSGSC SLPLXXXXXX XXXXXWGDPP SWLPNQLSTA  240
SSFGASIRET TLTESCSLYG ERGQQRIEKL LVQPGMERXX XXXXLVLHRN GSIGGFGVEK  300
KQSSLVLCWQ RKELLSASVW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-1781972192Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090295.14e-95scarecrow-like protein 6
SwissprotO813161e-71SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A059C5614e-95A0A059C561_EUCGR; Uncharacterized protein
STRINGXP_010056373.13e-94(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]