PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ote100001860041 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 184aa MW: 21353.8 Da PI: 4.7585 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 116.3 | 3.1e-36 | 1 | 118 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 +ppGfrF Ptdeelvv++L++k++ +++ +vi+++d+y ++PwdL+ k+ e ++wyfFs+r + +r+t+sg Ote100001860041|100001860041 1 MPPGFRFYPTDEELVVHFLHRKAALLPCHP-DVIPDLDLYPYDPWDLDGKAMCEGSKWYFFSRRTQ--------SRITESG 72 79*************************999.99**************976677899******9854........799**** PP NAM 82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 yW++ g +++++s +g+ vg+kk +f+ g+ ++g kt+W+m+eyrl Ote100001860041|100001860041 73 YWQQVGIEEPIYS-GGQRVGIKKYSAFFLGQISQGAKTNWIMQEYRL 118 *************.99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.06E-45 | 1 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.335 | 1 | 150 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.8E-22 | 2 | 118 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MPPGFRFYPT DEELVVHFLH RKAALLPCHP DVIPDLDLYP YDPWDLDGKA MCEGSKWYFF 60 SRRTQSRITE SGYWQQVGIE EPIYSGGQRV GIKKYSAFFL GQISQGAKTN WIMQEYRLSD 120 SNSSTRSSSR RRSSRVVDYS KWVICRVYER NCDSDDDDGT QLSCLDEVFL SLDDLDEISL 180 PNYS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-42 | 1 | 154 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-42 | 1 | 154 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-42 | 1 | 154 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-42 | 1 | 154 | 17 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swm_B | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swm_C | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swm_D | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swp_A | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swp_B | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swp_C | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
3swp_D | 8e-42 | 1 | 154 | 20 | 172 | NAC domain-containing protein 19 |
4dul_A | 8e-42 | 1 | 154 | 17 | 169 | NAC domain-containing protein 19 |
4dul_B | 8e-42 | 1 | 154 | 17 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027106335.1 | 2e-98 | NAC domain-containing protein 104-like | ||||
Refseq | XP_027159802.1 | 2e-98 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 1e-83 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A2G9FYG1 | 1e-100 | A0A2G9FYG1_9LAMI; Uncharacterized protein | ||||
STRING | XP_009762857.1 | 7e-94 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 |
Publications ? help Back to Top | |||
---|---|---|---|
|