PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.20.00.89.1 | ||||||||
Common Name | OT_ostta20g00800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 111aa MW: 12179.1 Da PI: 8.3635 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 47 | 5e-15 | 1 | 38 | 6 | 42 |
TCR 6 CnCkkskClkkYCeCfaagkkCsee.CkCedCkNkeek 42 CnCk+s+Clk+YCeCfaag+ C++ C+C +C+N+ e+ gw1.20.00.89.1 1 CNCKNSRCLKLYCECFAAGALCASArCRCANCMNTVEH 38 **********************9866********9876 PP | |||||||
2 | TCR | 50.2 | 5.1e-16 | 74 | 111 | 1 | 38 |
TCR 1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkN 38 ++++gC+Ck+s ClkkYCeCf+a +C+e+C+C +C+N gw1.20.00.89.1 74 RHNRGCHCKRSGCLKKYCECFQAAIYCAETCRCVSCEN 111 5899*********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51634 | 32.498 | 1 | 111 | IPR005172 | CRC domain |
Pfam | PF03638 | 2.1E-11 | 1 | 35 | IPR005172 | CRC domain |
SMART | SM01114 | 4.9E-9 | 1 | 38 | IPR033467 | Tesmin/TSO1-like CXC domain |
SMART | SM01114 | 1.7E-12 | 74 | 111 | IPR033467 | Tesmin/TSO1-like CXC domain |
Pfam | PF03638 | 2.1E-12 | 77 | 111 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
CNCKNSRCLK LYCECFAAGA LCASARCRCA NCMNTVEHAG ERTAAIETVL DRNPNAFRPK 60 IAAVASPSRD VALRHNRGCH CKRSGCLKKY CECFQAAIYC AETCRCVSCE N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5fd3_A | 4e-29 | 1 | 111 | 14 | 120 | Protein lin-54 homolog |
5fd3_B | 4e-29 | 1 | 111 | 14 | 120 | Protein lin-54 homolog |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00269 | DAP | Transfer from AT2G20110 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022840642.1 | 4e-75 | CRC domain | ||||
Swissprot | Q9SL70 | 6e-41 | TCX6_ARATH; Protein tesmin/TSO1-like CXC 6 | ||||
TrEMBL | A0A096P9E4 | 9e-74 | A0A096P9E4_OSTTA; CRC domain | ||||
TrEMBL | A0A1Y5I2F0 | 2e-70 | A0A1Y5I2F0_OSTTA; Tesmin/TSO1-like CXC domain-containing protein | ||||
STRING | A0A096P9E4 | 1e-74 | (Ostreococcus tauri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP323 | 15 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G20110.1 | 3e-43 | Tesmin/TSO1-like CXC domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|