PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.10.00.387.1 | ||||||||
Common Name | OT_ostta10g02070 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 102aa MW: 12132.8 Da PI: 10.7003 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58 | 2.2e-18 | 2 | 48 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+teEd++lv +v+++G ++W+ Iar + gR +kqc++rw+++l gw1.10.00.387.1 2 KGQWSTEEDQKLVGLVEKYGVRRWSYIARALS-GRVGKQCRERWNNHL 48 799*****************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 63 | 5.8e-20 | 54 | 96 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg WT +E+e++++a+ +lG++ W+ Ia++++ gRt++++k++w+ gw1.10.00.387.1 54 RGTWTLDEEEKFIEAHLELGNK-WSYIAKRLP-GRTENSVKNHWN 96 89********************.*********.***********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.652 | 1 | 52 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-12 | 1 | 50 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.92E-31 | 2 | 95 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.3E-27 | 3 | 56 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.80E-11 | 5 | 48 | No hit | No description |
Pfam | PF13921 | 6.1E-18 | 5 | 64 | No hit | No description |
PROSITE profile | PS51294 | 21.888 | 53 | 102 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-14 | 53 | 101 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.21E-9 | 56 | 96 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-21 | 57 | 101 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010183 | Biological Process | pollen tube guidance | ||||
GO:0045697 | Biological Process | regulation of synergid differentiation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
LKGQWSTEED QKLVGLVEKY GVRRWSYIAR ALSGRVGKQC RERWNNHLAP DIKRGTWTLD 60 EEEKFIEAHL ELGNKWSYIA KRLPGRTENS VKNHWNATRR RK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-42 | 1 | 102 | 3 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 6e-42 | 1 | 102 | 57 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 6e-42 | 1 | 102 | 57 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 9e-43 | 1 | 102 | 3 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 9e-43 | 1 | 102 | 3 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00442 | DAP | Transfer from AT4G18770 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022839809.1 | 4e-70 | SANT/Myb domain, partial | ||||
Swissprot | Q9S7L2 | 5e-47 | MYB98_ARATH; Transcription factor MYB98 | ||||
TrEMBL | A0A090M598 | 9e-69 | A0A090M598_OSTTA; SANT/Myb domain (Fragment) | ||||
STRING | A0A090M598 | 2e-69 | (Ostreococcus tauri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18770.1 | 2e-49 | myb domain protein 98 |
Publications ? help Back to Top | |||
---|---|---|---|
|