PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | e_gw1.16.00.288.1 | ||||||||
Common Name | OT_ostta16g01090 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 119aa MW: 13616.5 Da PI: 9.9879 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.8 | 9.2e-17 | 19 | 65 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + W + Ede l+++++++G ++W+ Ia+ m+ gR +kqc++r++++l e_gw1.16.00.288.1 19 QQWRKHEDEELLQLIAKHGAKRWSYIASLMPGGRRGKQCRDRYLNHL 65 68*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.9 | 1.7e-16 | 72 | 113 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 g WTteE+++lv+++k lG++ W++ a+ ++ gR ++ +k++w+ e_gw1.16.00.288.1 72 GEWTTEEEQILVEGHKALGTK-WAALAKLLP-GRPENAIKNHWH 113 68*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.307 | 13 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 5.3E-13 | 17 | 67 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.83E-27 | 17 | 112 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.1E-14 | 19 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-23 | 20 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.26E-11 | 21 | 65 | No hit | No description |
PROSITE profile | PS51294 | 20.66 | 66 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-11 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-14 | 72 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.13E-9 | 73 | 113 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.1E-19 | 73 | 118 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0016787 | Molecular Function | hydrolase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MDLPSTSDPE NANSRGISQQ WRKHEDEELL QLIAKHGAKR WSYIASLMPG GRRGKQCRDR 60 YLNHLRPGIV IGEWTTEEEQ ILVEGHKALG TKWAALAKLL PGRPENAIKN HWHATMRCK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 4e-33 | 17 | 119 | 3 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 1e-32 | 13 | 119 | 53 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-32 | 13 | 119 | 53 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 4e-33 | 17 | 119 | 3 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 4e-33 | 17 | 119 | 3 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022840319.1 | 1e-82 | P-loop containing nucleoside triphosphate hydrolase | ||||
Swissprot | Q9S7L2 | 6e-34 | MYB98_ARATH; Transcription factor MYB98 | ||||
TrEMBL | A0A096P8H8 | 3e-81 | A0A096P8H8_OSTTA; p-loop containing nucleoside triphosphate hydrolase | ||||
STRING | A0A096P8H8 | 5e-82 | (Ostreococcus tauri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18770.1 | 3e-36 | myb domain protein 98 |
Publications ? help Back to Top | |||
---|---|---|---|
|