PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os12g41880.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 155aa MW: 17057 Da PI: 6.7255 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 53.3 | 9.4e-17 | 109 | 144 | 1 | 37 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37 +ep+YVNaKQy++Il+RRq+Rak+e+ekkl k+rk LOC_Os12g41880.1 109 EEPVYVNAKQYNAILRRRQSRAKAESEKKL-VKGRKV 144 69****************************.999985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 3.5E-7 | 107 | 153 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 18.084 | 108 | 154 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.6E-12 | 110 | 144 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 113 | 133 | IPR018362 | CCAAT-binding factor, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MTSVVHDVSG NHGADERQKQ QRQGEPEDQQ EASVTSTDSH TMVATPSTDY ATPYAHHDMA 60 HAMQGQIAYA NIDPYYGSLY AAYGGQPMMH PPLVGMHPAG LPLPTDAIEE PVYVNAKQYN 120 AILRRRQSRA KAESEKKLVK GRKVNLISTF YETI* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.5602 | 0.0 | callus| leaf| panicle| stem |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os12g41880.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os12g41880 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT834679 | 0.0 | CT834679.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN051A15, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015618406.1 | 1e-105 | nuclear transcription factor Y subunit A-7 isoform X3 | ||||
TrEMBL | A0A0E0FEF5 | 1e-101 | A0A0E0FEF5_9ORYZ; Uncharacterized protein | ||||
TrEMBL | Q2QM94 | 1e-101 | Q2QM94_ORYSJ; CCAAT-box transcription factor complex WHAP5, putative, expressed | ||||
STRING | OMERI12G14080.1 | 1e-102 | (Oryza meridionalis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-27 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os12g41880.1 |