PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g37970.3
Common NameLOC4352559, MYB17, MYBAS2, Os12g0567300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 178aa    MW: 20118.8 Da    PI: 6.0093
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g37970.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-16243548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      ++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  LOC_Os12g37970.3  2 SPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43
                      899***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.01E-12143No hitNo description
SMARTSM007173.8E-11145IPR001005SANT/Myb domain
PROSITE profilePS5129423.752147IPR017930Myb domain
PfamPF002494.0E-14242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-19244IPR009057Homeodomain-like
SuperFamilySSF466891.56E-12249IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MSPHEERLIL ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER KSNMSPSSSS  60
SSLTYQSCHP ETPSMIIGIE EQELHGGSGC ITSIMKSTPV DMDGYPMDQI WMEIEAPNVL  120
PGPCFDEAKD SASNSLSGPL LPYPMWDYYC PETCLRMDDE IKVAPQFGYG KGVGPCY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.116380.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329924230.0
Expression AtlasQ4JL76-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g37970.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g37970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4957850.0AJ495785.1 Oryza sativa Japonica Group mRNA for MYB17 protein.
GenBankDQ0752610.0DQ075261.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-1 mRNA, complete cds, alternatively spliced.
GenBankDQ0752620.0DQ075262.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-2 mRNA, complete cds, alternatively spliced.
GenBankDQ0752630.0DQ075263.2 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-3 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620228.11e-130myb-related protein MYBAS2 isoform X1
RefseqXP_025877776.11e-130myb-related protein MYBAS2 isoform X2
SwissprotQ4JL761e-131MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA2ZLS51e-129A2ZLS5_ORYSI; Uncharacterized protein
TrEMBLF4MGP31e-130F4MGP3_ORYSJ; Myb family transcription factor, putative, expressed
STRINGOGLUM12G17720.11e-130(Oryza glumipatula)
STRINGORUFI12G17930.11e-130(Oryza rufipogon)
STRINGOS12T0567300-001e-130(Oryza sativa)
STRINGORGLA12G0141600.11e-130(Oryza glaberrima)
STRINGORGLA12G0206100.11e-130(Oryza glaberrima)
STRINGOBART12G16130.11e-130(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-28myb domain protein 48
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  3. Li J, et al.
    A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice.
    J. Exp. Bot., 2006. 57(6): p. 1263-73
    [PMID:16531467]