PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47460.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 173aa    MW: 19530.2 Da    PI: 6.9103
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47460.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-16243548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      ++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  LOC_Os11g47460.4  2 SPKEEHLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43
                      899***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001672.83E-11143No hitNo description
SMARTSM007179.7E-10145IPR001005SANT/Myb domain
PROSITE profilePS5129424.29147IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-20244IPR009057Homeodomain-like
SuperFamilySSF466891.25E-12247IPR009057Homeodomain-like
PfamPF002497.3E-15242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSPKEEHLII ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER RGDMSPSSSS  60
SSLVYQSCLL DTVPIISMDG GDIHDDRSCM ARVLKSTQSV MDGYTMDQIW KEIEAPGAPS  120
LLGIDEGKDK ACSNLPCPLL TSTMSDYSCP EVFWKIDNEE TRMLATQSGY GK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101740.0leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasF4MGF7
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47460.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116260.0AK111626.1 Oryza sativa Japonica Group cDNA clone:J013113N19, full insert sequence.
GenBankDQ0752580.0DQ075258.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-1 mRNA, complete cds, alternatively spliced.
GenBankDQ0752590.0DQ075259.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-2 mRNA, complete cds, alternatively spliced.
GenBankDQ0752600.0DQ075260.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-3 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617959.11e-125myb-related protein MYBAS1 isoform X2
RefseqXP_025877324.11e-125myb-related protein MYBAS1 isoform X1
SwissprotQ53NK61e-126MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLF4MGF71e-125F4MGF7_ORYSJ; Myb family transcription factor, putative, expressed
STRINGORUFI11G25190.11e-125(Oryza rufipogon)
STRINGOS11T0700500-011e-125(Oryza sativa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.14e-33myb domain protein 59
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]