PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os11g39000.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 101aa MW: 10867.4 Da PI: 7.3656 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 28.3 | 3.2e-09 | 23 | 62 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 ++ + +++L+ +lP++ ++ + K s ae+L++A++YI+ L LOC_Os11g39000.2 23 QMAELISKLQAVLPTRGGEANAKASSAEVLQEACRYIRRL 62 78899**********88*********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 8.55 | 8 | 62 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 2.09E-8 | 22 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 4.1E-6 | 23 | 62 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 1.5E-7 | 23 | 65 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0040008 | Biological Process | regulation of growth | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MSSSRRSRTS SRLAAAPPPT DEQMAELISK LQAVLPTRGG EANAKASSAE VLQEACRYIR 60 RLHREADALS ERLAELLLLQ PSDLAINGAD VPDLIRSLLM * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os11g39000.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os11g39000 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT833202 | 1e-169 | CT833202.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA029D09, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015616701.1 | 5e-64 | transcription factor ILI2 isoform X2 | ||||
Swissprot | B8BLA3 | 9e-55 | ILI2_ORYSI; Transcription factor ILI2 | ||||
Swissprot | Q2R1J3 | 9e-55 | ILI2_ORYSJ; Transcription factor ILI2 | ||||
TrEMBL | A0A0D3HNS7 | 1e-62 | A0A0D3HNS7_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0HS14 | 1e-62 | A0A0E0HS14_ORYNI; Uncharacterized protein | ||||
STRING | ONIVA06G20810.1 | 2e-63 | (Oryza nivara) | ||||
STRING | OBART11G19180.1 | 2e-63 | (Oryza barthii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G39860.1 | 8e-11 | bHLH family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os11g39000.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|