PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os11g03440.1 | ||||||||
Common Name | LOC4349657, Os11g0128500, OsJ_32794, OSNPB_110128500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 309aa MW: 33599.7 Da PI: 5.8377 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.2 | 6.9e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl LOC_Os11g03440.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 46.5 | 8.3e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++v++ +lG++ W++Ia++++ Rt++++k++w+++l LOC_Os11g03440.1 67 RGNFTAHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.517 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.86E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.37E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-23 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.1E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.443 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.6E-12 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.24E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010118 | Biological Process | stomatal movement | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020048 | anatomy | microspore | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0007130 | developmental stage | sporophyte reproductive stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 309 aa Download sequence Send to blast |
MGRPPCCDKE GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TAHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLAAAA 120 NSTSAASNRH PIFADATFPS AAGSHTVSSN SDVNQMAAIA RRSPFADCPS SSYASSMDNI 180 SKLLDGFMKT NSPSPPPPPL QHYDGGYYDD VKPAVDVVGN PLLSSFDCMS GADLDCCFDV 240 HQQQPASSFM EYGGYGGGYG DESKQQLMNQ AAAPLSSIEK WLFDEAAAEQ VADLMDLSDG 300 CCSVPMMF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-25 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 3e-25 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 3e-25 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-25 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.84816 | 0.0 | leaf |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 297611148 | 0.0 | ||||
Expression Atlas | Q2RB26 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00132 | DAP | Transfer from AT1G08810 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os11g03440.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os11g03440 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK241549 | 0.0 | AK241549.1 Oryza sativa Japonica Group cDNA, clone: J065176M15, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015616542.1 | 0.0 | myb-related protein 306 | ||||
Swissprot | B3VTV7 | 2e-91 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A2ZB04 | 0.0 | A2ZB04_ORYSI; Uncharacterized protein | ||||
TrEMBL | Q2RB26 | 0.0 | Q2RB26_ORYSJ; Myb-like DNA-binding domain containing protein, expressed | ||||
STRING | OS11T0128500-01 | 0.0 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 3e-80 | myb domain protein 60 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os11g03440.1 |
Entrez Gene | 4349657 |
Publications ? help Back to Top | |||
---|---|---|---|
|