PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g41200.1
Common NameLOC4349385, Os10g0561400, OsJ_32461, OSJNBb0089A17.8, OSNPB_100561400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 319aa    MW: 34489.3 Da    PI: 6.957
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g41200.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-1395139347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ +++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  LOC_Os10g41200.1  95 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 139
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.7E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.99788144IPR017930Myb domain
SuperFamilySSF466892.99E-1790145IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1991143IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-1192138IPR009057Homeodomain-like
SMARTSM007171.0E-1092142IPR001005SANT/Myb domain
CDDcd001675.65E-995140No hitNo description
PfamPF002494.8E-1195139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKIFGVRL TDGSIRKSAS MGNLSLLSSA AGSTSGGASP  60
ADGPDAAPTA ADGYASDDFV QGSSSATRDR KKGVPWTEEE HRRFLLGLQK LGKGDWRGIS  120
RNFVVSRTPT QVASHAQKYF IRQSNMTRRK RRSSLFDMVP DESMDLPPLP GGQEPETQVL  180
NQPALPPPRE EEEVDSMESD TSAVAESSSA SAIMPDNLQS TYPVIVPAYF SPFLQFSVPF  240
WQNQKDEDGP VQETHEIVKP VPVHSKSPIN VDELVGMSKL SIGESNQETV STSLSLNLVG  300
GQNRQSAFHA NPPTRAQA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.487211e-174callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329907671e-174
Expression AtlasQ7XC57-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Function -- GeneRIF ? help Back to Top
  1. MYB30 regulates cold tolerance through the negative regulation of the BMY genes by interacting with JAZ9 to fine-tune the starch breakdown.
    [PMID: 28062835]
  2. MYB30, MYB55 and MYB110 are involved in the signal pathway between microbe-associated molecular pattern perception and cinnamate/monolignol synthesis, and have important roles for plant immunity.
    [PMID: 29562362]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g41200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g41200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1010620.0AK101062.1 Oryza sativa Japonica Group cDNA clone:J033022I10, full insert sequence.
GenBankEU8372540.0EU837254.1 Oryza sativa Japonica Group clone KCS344D12 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614288.10.0transcription factor MYBS3
SwissprotQ7XC570.0MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A0E0IWI70.0A0A0E0IWI7_ORYNI; Uncharacterized protein
STRINGOS10T0561400-020.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.17e-99MYB_related family protein
Publications ? help Back to Top
  1. Lu CA,Ho TH,Ho SL,Yu SM
    Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.
    Plant Cell, 2002. 14(8): p. 1963-80
    [PMID:12172034]
  2. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  3. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  4. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]
  5. Lv Y, et al.
    The OsMYB30 Transcription Factor Suppresses Cold Tolerance by Interacting with a JAZ Protein and Suppressing β-Amylase Expression.
    Plant Physiol., 2017. 173(2): p. 1475-1491
    [PMID:28062835]
  6. Kishi-Kaboshi M,Seo S,Takahashi A,Hirochika H
    The MAMP-Responsive MYB Transcription Factors MYB30, MYB55 and MYB110 Activate the HCAA Synthesis Pathway and Enhance Immunity in Rice.
    Plant Cell Physiol., 2018. 59(5): p. 903-915
    [PMID:29562362]