PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os09g35790.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 104aa MW: 11218.4 Da PI: 4.1541 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 85.8 | 5.9e-27 | 39 | 97 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y+++ed++++++isw+e+g++fvv+ + efa+++LpkyFkh+nf+SFvRQLn+Y LOC_Os09g35790.3 39 FLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY 97 9********************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.9E-28 | 31 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 5.9E-23 | 35 | 101 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 5.78E-25 | 36 | 98 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 7.0E-23 | 39 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-16 | 39 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-16 | 77 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-16 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MAEQGAGEAD AGGGEPPPAA VMTAAAEALA GQRSLPTPFL TKTYQLVEDP AVDDVISWNE 60 DGSTFVVWRP AEFARDLLPK YFKHNNFSSF VRQLNTYPND GTW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 1e-18 | 29 | 97 | 11 | 78 | Heat shock factor protein 1 |
5d5u_B | 1e-18 | 30 | 97 | 21 | 87 | Heat shock factor protein 1 |
5d5v_B | 1e-18 | 30 | 97 | 21 | 87 | Heat shock factor protein 1 |
5d5v_D | 1e-18 | 30 | 97 | 21 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.11941 | 1e-159 | callus| leaf| panicle| root| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32991754 | 1e-159 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00432 | DAP | Transfer from AT4G11660 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os09g35790.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os09g35790 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP005681 | 1e-162 | AP005681.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1439_F07. | |||
GenBank | AP014965 | 1e-162 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012617 | 1e-162 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015612527.1 | 8e-64 | heat stress transcription factor B-2c isoform X4 | ||||
Refseq | XP_025876147.1 | 8e-64 | heat stress transcription factor B-2c isoform X5 | ||||
Swissprot | Q652B0 | 4e-64 | HFB2C_ORYSJ; Heat stress transcription factor B-2c | ||||
TrEMBL | A0A0E0QU38 | 3e-62 | A0A0E0QU38_ORYRU; Uncharacterized protein | ||||
TrEMBL | A2Z3A9 | 3e-62 | A2Z3A9_ORYSI; Uncharacterized protein | ||||
TrEMBL | B8AMF0 | 4e-64 | B8AMF0_ORYSI; Uncharacterized protein | ||||
STRING | ORUFI09G18440.1 | 5e-63 | (Oryza rufipogon) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11660.1 | 5e-40 | HSF family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os09g35790.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|