PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os09g29960.1 | ||||||||
Common Name | LOC9268074, Os09g0475800, P0556A05.8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 231aa MW: 23762.4 Da PI: 9.4724 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 120.8 | 5e-38 | 42 | 98 | 6 | 62 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss LOC_Os09g29960.1 42 DPCPRCESRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGSRKSSTSS 98 57**************************************************98876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 3.0E-23 | 41 | 90 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.705 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.6E-32 | 43 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 44 | 80 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 231 aa Download sequence Send to blast |
MQEAGRRPAP QFAGVDLRRP KGYPAAAQLT PAAEEAAAGV GDPCPRCESR DTKFCYYNNY 60 NTSQPRHFCK SCRRYWTKGG SLRNVPVGGG SRKSSTSSSS AAAAAASSSS SPSSPAKSPK 120 RSKNSKRRRV SPPPPQPVPA PPPPTTADAA DVAAPTAPEA TTKKAPEDLT AAAATQPAVA 180 LGLGVADGGG GGKEHLDTSP FEWPSGCDLG PYWPTGVFAD TDPSLFLNLP * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 125 | 129 | KRRRV |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.81252 | 0.0 | panicle |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | Q651Z2 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in all tissues examined. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00672 | SELEX | Transfer from GRMZM2G009406 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os09g29960.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os09g29960 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP005759 | 0.0 | AP005759.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0556A05. | |||
GenBank | AP014965 | 0.0 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
GenBank | KC996733 | 0.0 | KC996733.1 Oryza sativa transcription factor Dof25 (Dof25) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015610919.1 | 1e-163 | dof zinc finger protein MNB1A | ||||
Swissprot | P38564 | 1e-55 | MNB1A_MAIZE; Dof zinc finger protein MNB1A | ||||
TrEMBL | A0A0E0QSR1 | 1e-162 | A0A0E0QSR1_ORYRU; Uncharacterized protein | ||||
TrEMBL | Q651Z2 | 1e-162 | Q651Z2_ORYSJ; Os09g0475800 protein | ||||
TrEMBL | T2CYQ8 | 1e-162 | T2CYQ8_ORYSA; Transcription factor Dof25 | ||||
STRING | ORUFI09G14860.1 | 1e-163 | (Oryza rufipogon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP140 | 37 | 367 | Representative plant | OGRP38 | 17 | 445 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G51700.1 | 5e-26 | DOF zinc finger protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os09g29960.1 |
Entrez Gene | 9268074 |
Publications ? help Back to Top | |||
---|---|---|---|
|