PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os08g15020.1 | ||||||||
Common Name | LOC4345070, Os08g0248700, OSJNBb0003H03.23, OSNPB_080248700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 317aa MW: 34397.2 Da PI: 6.3143 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.1 | 3.1e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd l+++++++G+g +W + ++++g++R++k+c++rw++yl LOC_Os08g15020.1 14 KGPWSPEEDAMLKNYIEEHGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 39.7 | 1.2e-12 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T+eEd ++ + G++ W+ Ia+ ++ gRt++++k++w++ LOC_Os08g15020.1 69 GDFTPEEDSIICSLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111 789******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.796 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.13E-27 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.0E-13 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-24 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.91E-10 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 21.497 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.0E-11 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-23 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.18E-8 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
GO:0035987 | Biological Process | endodermal cell differentiation | ||||
GO:0045597 | Biological Process | positive regulation of cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000021 | Biological Process | regulation of ion homeostasis | ||||
GO:2000067 | Biological Process | regulation of root morphogenesis | ||||
GO:0048226 | Cellular Component | Casparian strip | ||||
GO:0000975 | Molecular Function | regulatory region DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009066 | anatomy | anther | ||||
PO:0001004 | developmental stage | anther development stage | ||||
PO:0007130 | developmental stage | sporophyte reproductive stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 317 aa Download sequence Send to blast |
MGRAPCCDKA TVKKGPWSPE EDAMLKNYIE EHGTGGNWIA LPHKIGLKRC GKSCRLRWLN 60 YLRPNIKHGD FTPEEDSIIC SLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLLGR 120 RKDRGGGHHH RSQSTADDLP AGGDGGMNDG GGGGGERSLS ASAMERIQLC MQLQELQNPL 180 SIHHNPLLSH QWPSKATIDD QNHNNVTVAE HGMSSSVSDH HRLDGQQLES GAGAAAMQQA 240 SPSSGGENSN VVVAIEAELQ ELLYAGGGAI VDGGAPPQGD VDWWSYDQGK QSPVTCWDFT 300 PETSSIFQDY ATVYDI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-23 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.49824 | 0.0 | flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 37988451 | 0.0 | ||||
Expression Atlas | Q6Z0A5 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In roots, expressed in endodermal cells from the late elongation zones to the differentiation zone and, to a lower extent, in endodermal cells of the meristematic zone. {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, roots (endodermis-specific) and seedlings. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os08g15020.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os08g15020 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK111788 | 0.0 | AK111788.1 Oryza sativa Japonica Group cDNA clone:J023093J22, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015648313.1 | 0.0 | transcription factor MYB36 | ||||
Swissprot | Q9FKL2 | 3e-85 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | A0A0E0I987 | 0.0 | A0A0E0I987_ORYNI; Uncharacterized protein | ||||
TrEMBL | A0A0E0QGB0 | 0.0 | A0A0E0QGB0_ORYRU; Uncharacterized protein | ||||
TrEMBL | Q6Z0A5 | 0.0 | Q6Z0A5_ORYSJ; Os08g0248700 protein | ||||
STRING | ORUFI08G08790.1 | 0.0 | (Oryza rufipogon) | ||||
STRING | OS08T0248700-01 | 0.0 | (Oryza sativa) | ||||
STRING | ONIVA08G08510.1 | 0.0 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP135 | 38 | 412 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 2e-78 | myb domain protein 36 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os08g15020.1 |
Entrez Gene | 4345070 |
Publications ? help Back to Top | |||
---|---|---|---|
|