Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | G2-like | 103.3 | 1.5e-32 | 246 | 300 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
k+r+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
LOC_Os07g25710.1 246 KTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 300
68****************************************************8 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}. |
UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}. |
Publications
? help Back to Top |
- Cooper B, et al.
A network of rice genes associated with stress response and seed development. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50 [PMID:12684538] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Zhou J, et al.
OsPHR2 is involved in phosphate-starvation signaling and excessive phosphate accumulation in shoots of plants. Plant Physiol., 2008. 146(4): p. 1673-86 [PMID:18263782] - Wang C, et al.
Involvement of OsSPX1 in phosphate homeostasis in rice. Plant J., 2009. 57(5): p. 895-904 [PMID:19000161] - Wu P,Wang X
Role of OsPHR2 on phosphorus homeostasis and root hairs development in rice (Oryza sativa L.). Plant Signal Behav, 2008. 3(9): p. 674-5 [PMID:19704822] - Liu F, et al.
OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice. Plant J., 2010. 62(3): p. 508-17 [PMID:20149131] - Zhang Q,Wang C,Tian J,Li K,Shou H
Identification of rice purple acid phosphatases related to phosphate starvation signalling. Plant Biol (Stuttg), 2011. 13(1): p. 7-15 [PMID:21143719] - Wu Z,Ren H,McGrath SP,Wu P,Zhao FJ
Investigating the contribution of the phosphate transport pathway to arsenic accumulation in rice. Plant Physiol., 2011. 157(1): p. 498-508 [PMID:21715673] - Chen J, et al.
OsPHF1 regulates the plasma membrane localization of low- and high-affinity inorganic phosphate transporters and determines inorganic phosphate uptake and translocation in rice. Plant Physiol., 2011. 157(1): p. 269-78 [PMID:21753117] - Wang C, et al.
Functional characterization of the rice SPX-MFS family reveals a key role of OsSPX-MFS1 in controlling phosphate homeostasis in leaves. New Phytol., 2012. 196(1): p. 139-48 [PMID:22803610] - Tian J, et al.
Overexpression of OsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice. J Integr Plant Biol, 2012. 54(9): p. 631-9 [PMID:22805094] - Shen C, et al.
OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.). Plant Cell Environ., 2013. 36(3): p. 607-20 [PMID:22913536] - Wu P,Shou H,Xu G,Lian X
Improvement of phosphorus efficiency in rice on the basis of understanding phosphate signaling and homeostasis. Curr. Opin. Plant Biol., 2013. 16(2): p. 205-12 [PMID:23566853] - Wang S, et al.
Auxin response factor (OsARF12), a novel regulator for phosphate homeostasis in rice (Oryza sativa). New Phytol., 2014. 201(1): p. 91-103 [PMID:24111723] - Shi J, et al.
The paralogous SPX3 and SPX5 genes redundantly modulate Pi homeostasis in rice. J. Exp. Bot., 2014. 65(3): p. 859-70 [PMID:24368504] - Li S,Wang C,Zhou L,Shou H
Oxygen deficit alleviates phosphate overaccumulation toxicity in OsPHR2 overexpression plants. J. Plant Res., 2014. 127(3): p. 433-40 [PMID:24687599] - Lv Q, et al.
SPX4 Negatively Regulates Phosphate Signaling and Homeostasis through Its Interaction with PHR2 in Rice. Plant Cell, 2014. 26(4): p. 1586-1597 [PMID:24692424] - Wang Z, et al.
Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner. Proc. Natl. Acad. Sci. U.S.A., 2014. 111(41): p. 14953-8 [PMID:25271318] - Ruan W, et al.
Genetic manipulation of a high-affinity PHR1 target cis-element to improve phosphorous uptake in Oryza sativa L. Plant Mol. Biol., 2015. 87(4-5): p. 429-40 [PMID:25657119] - Guo M, et al.
Integrative Comparison of the Role of the PHOSPHATE RESPONSE1 Subfamily in Phosphate Signaling and Homeostasis in Rice. Plant Physiol., 2015. 168(4): p. 1762-76 [PMID:26082401] - Zhou Z, et al.
SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] - Zhang K, et al.
Down-regulation of OsSPX1 caused semi-male sterility, resulting in reduction of grain yield in rice. Plant Biotechnol. J., 2016. 14(8): p. 1661-72 [PMID:26806409] - Wild R, et al.
Control of eukaryotic phosphate homeostasis by inositol polyphosphate sensor domains. Science, 2016. 352(6288): p. 986-90 [PMID:27080106] - Cao Y, et al.
Identification and expression analysis of OsLPR family revealed the potential roles of OsLPR3 and 5 in maintaining phosphate homeostasis in rice. BMC Plant Biol., 2016. 16(1): p. 210 [PMID:27716044]
|