PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os07g03770.1 | ||||||||
Common Name | HOS3, LOC4342320, Os07g0129700, OSH15, OSJNBa0088O14.22, P0483E09.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 356aa MW: 38590.4 Da PI: 7.0002 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30 | 9e-10 | 281 | 316 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ LOC_Os07g03770.1 281 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 316 4679*****************************885 PP | |||||||
2 | ELK | 35.7 | 1.8e-12 | 236 | 257 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK qLl+KYsgyL+sL+qEFs LOC_Os07g03770.1 236 ELKFQLLKKYSGYLSSLRQEFS 257 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 6.8E-23 | 89 | 133 | IPR005540 | KNOX1 |
Pfam | PF03790 | 4.0E-22 | 91 | 131 | IPR005540 | KNOX1 |
SMART | SM01256 | 5.4E-30 | 136 | 187 | IPR005541 | KNOX2 |
Pfam | PF03791 | 7.8E-24 | 141 | 185 | IPR005541 | KNOX2 |
PROSITE profile | PS51213 | 11.401 | 236 | 256 | IPR005539 | ELK domain |
SMART | SM01188 | 5.7E-7 | 236 | 257 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.2E-9 | 236 | 257 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.892 | 256 | 319 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.24E-19 | 257 | 330 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 4.4E-13 | 258 | 323 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-28 | 261 | 320 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.73E-12 | 268 | 320 | No hit | No description |
Pfam | PF05920 | 9.9E-17 | 276 | 315 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 294 | 317 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009047 | anatomy | stem | ||||
PO:0007010 | developmental stage | whole plant fruit ripening stage | ||||
PO:0007130 | developmental stage | sporophyte reproductive stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 356 aa Download sequence Send to blast |
MDQSFGNLGG GGGAGGSGKA AASSFLQLPL STAAAATAYY GTPLALHQAA AAAGPSQYHG 60 HGHPHHGGGH HHSKHGGAGG GEISAAEAES IKAKIMAHPQ YSALLAAYLD CQKVGAPPEV 120 LERLTATAAK LDARPPGRHD ARDPELDQFM EAYCNMLAKY REELTRPIDE AMEFLKRVES 180 QLDTIAGGAH GGGAGSARLL LADGKSECVG SSEDDMDPSG RENEPPEIDP RAEDKELKFQ 240 LLKKYSGYLS SLRQEFSKKK KKGKLPKEAR QKLLHWWELH YKWPYPSETE KIALAESTGL 300 DQKQINNWFI NQRKRHWKPS EDMPFVMMEG FHPQNAAALY MDGPFMADGM YRLGS* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.2254 | 0.0 | callus| panicle| root| stem| vegetative meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 156764787 | 0.0 | ||||
Expression Atlas | O80416 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the embryo at 4 days after pollination (DAP) in the ventral and basal part of the embryo including the initial of the shoot apical meristem (SAM). At 5 DAP, expressed at the ventral side of the embryo, but the expression within SAM is down-regulated. At 7 DAP, expression is restricted to the boundaries between the embryonic organs, between the scutellum and the coleoptile, the coleoptile and the second leaf primordium, the shoot apical meristem and the first leaf primordium, the first leaf primordium and the coleoptile, the coleoptile and the epiblast and at the tip of the epiblast, but not in the leaf primordia. {ECO:0000269|PubMed:10080693}. | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the embryo at 4 days after pollination (DAP) in the ventral and basal part of the embryo, including the initial of the shoot apical meristem (SAM). At 5 DAP, expressed at the ventral side of the embryo, but the expression within SAM is down-regulated. At 7 DAP, expression is restricted to the boundaries between the embryonic organs, between the scutellum and the coleoptile, the coleoptile and the second leaf primordium, the shoot apical meristem and the first leaf primordium, the first leaf primordium and the coleoptile, the coleoptile and the epiblast and at the tip of the epiblast, but not in the leaf primordia. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:9869405}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stems, rachis and inflorescence. {ECO:0000269|PubMed:9869405}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:9869405}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os07g03770.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search O80416 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os07g03770 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB016071 | 0.0 | AB016071.1 Oryza sativa Japonica Group mRNA, complete cds. | |||
GenBank | FJ940208 | 0.0 | FJ940208.1 Oryza sativa Japonica Group clone KCB937E04 homeobox protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015646117.1 | 0.0 | homeobox protein knotted-1-like 12 | ||||
Swissprot | O65034 | 0.0 | KNOSC_ORYSI; Homeobox protein knotted-1-like 12 | ||||
Swissprot | O80416 | 0.0 | KNOSC_ORYSJ; Homeobox protein knotted-1-like 12 | ||||
TrEMBL | B8B756 | 0.0 | B8B756_ORYSI; Uncharacterized protein | ||||
TrEMBL | B9FVB7 | 0.0 | B9FVB7_ORYSJ; Homeobox protein | ||||
STRING | OS07T0129700-01 | 0.0 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4061 | 38 | 73 | Representative plant | OGRP167 | 17 | 148 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 1e-101 | KNOTTED-like from Arabidopsis thaliana |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os07g03770.1 |
Entrez Gene | 4342320 |