PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LOC_Os07g01820.3

Common Name

LOC4342214, MADS15, OJ1567_G09.109-1, Os07g0108900, P0585H11.124-1, RAP1A

Organism

Oryza sativa subsp. japonica

Taxonomic ID

39947

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

MIKC_MADS

Protein Properties

Length: 268aa MW: 30390.7 Da PI: 9.4939

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LOC_Os07g01820.3	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.9	4.2e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++ LOC_Os07g01820.3 9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59 79***********************************************86 PP
2	K-box	104.2	1.6e-34	78	173	4	99
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 + s+e++ + ++++e++kLk++ie++q+ ++hl+GedLesL+lkeLqqLeqqLe+slk+i s+K++l+le+i+elqkke++lqeenkaL+k LOC_Os07g01820.3 78 KALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQK 170 556667888899********************************************************************************9 PP K-box 97 kle 99 +l LOC_Os07g01820.3 171 ELV 173 986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.4E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.674	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.5E-35	2	88	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.40E-42	2	76	No hit	No description
PRINTS	PR00404	1.9E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.6E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	8.3E-29	84	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	17.129	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009047	anatomy	stem
PO:0007010	developmental stage	whole plant fruit ripening stage
PO:0007130	developmental stage	sporophyte reproductive stage

Sequence ? help Back to Top
Protein Sequence Length: 268 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP KGKLYEYATD 60 SRMDKILERY ERYSYAEKAL ISAESESEGN WCHEYRKLKA KIETIQKCHK HLMGEDLESL 120 NLKELQQLEQ QLESSLKHII SRKSHLMLES ISELQKKERS LQEENKALQK ELVERQKNVR 180 GQQQVGQWDQ TQVQAQAQAQ PQAQTSSSSS SMLRDQQALL PPQNICYPPV MMGERNDAAA 240 AAAVAAQGQV QLRIGGLPPW MLSHLNA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-22	1	74	1	73	MEF2 CHIMERA
6byy_B	1e-22	1	74	1	73	MEF2 CHIMERA
6byy_C	1e-22	1	74	1	73	MEF2 CHIMERA
6byy_D	1e-22	1	74	1	73	MEF2 CHIMERA
6bz1_A	1e-22	1	74	1	73	MEF2 CHIMERA
6bz1_B	1e-22	1	74	1	73	MEF2 CHIMERA
6bz1_C	1e-22	1	74	1	73	MEF2 CHIMERA
6bz1_D	1e-22	1	74	1	73	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.12750	0.0	flower\| panicle

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	32982706	0.0
Expression Atlas	Q6Q9I2	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the floral meristem at very early stage of the spikelet (rice flower) development. Expressed in lemmas, paleas and lodicules from early to late stage of flower development. {ECO:0000269\|PubMed:10945340}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Function -- GeneRIF ? help Back to Top
MADS15 role during the development of rice florets. [PMID: 27689766]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LOC_Os07g01820.3

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q6Q9I2

Phenotype -- Mutation ? help Back to Top
Source	ID
RiceGE	Os07g01820

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB003325	0.0	AB003325.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31864.
GenBank	AY551920	0.0	AY551920.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS215 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015645259.1	0.0	MADS-box transcription factor 15 isoform X2
Swissprot	Q6Q9I2	0.0	MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBL	A0A0E0E6U8	0.0	A0A0E0E6U8_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0Q385	0.0	A0A0E0Q385_ORYRU; Uncharacterized protein
STRING	OS07T0108900-02	0.0	(Oryza sativa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	4e-72	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	LOC_Os07g01820.3
Entrez Gene	4342214

Publications ? help Back to Top
Shinozuka Y, et al. Isolation and characterization of rice MADS box gene homologues and their RFLP mapping. DNA Res., 1999. 6(2): p. 123-9 [PMID:10382970] Moon YH, et al. Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol., 1999. 120(4): p. 1193-204 [PMID:10444103] Kyozuka J,Kobayashi T,Morita M,Shimamoto K Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes. Plant Cell Physiol., 2000. 41(6): p. 710-8 [PMID:10945340] Lim J,Moon YH,An G,Jang SK Two rice MADS domain proteins interact with OsMADS1. Plant Mol. Biol., 2000. 44(4): p. 513-27 [PMID:11197326] Cooper B, et al. A network of rice genes associated with stress response and seed development. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50 [PMID:12684538] Cai Q, et al. [PAEs in composts of municipal sludge and rice straw]. Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6 [PMID:14997664] Wang K, et al. DEP and AFO regulate reproductive habit in rice. PLoS Genet., 2010. 6(1): p. e1000818 [PMID:20107517] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Ramanujam R,Yishi X,Liu H,Naqvi NI Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting. PLoS ONE, 2012. 7(7): p. e41084 [PMID:22927898] Ang TN,Ngoh GC,Chua AS,Lee MG Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses. Biotechnol Biofuels, 2012. 5(1): p. 67 [PMID:22958710] Ren D, et al. MULTI-FLORET SPIKELET1, which encodes an AP2/ERF protein, determines spikelet meristem fate and sterile lemma identity in rice. Plant Physiol., 2013. 162(2): p. 872-84 [PMID:23629832] Zhang G,Huang K,Jiang X,Huang D,Yang Y Acetylation of rice straw for thermoplastic applications. Carbohydr Polym, 2013. 96(1): p. 218-26 [PMID:23688473] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Hu S, et al. A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7. Rice (N Y), 2013. 6(1): p. 24 [PMID:24280027] Ji Y, et al. A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China. J. Hazard. Mater., 2014. 279: p. 133-40 [PMID:25051237] Huang Y, et al. Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai. Biomed. Environ. Sci., 2014. 27(10): p. 819-23 [PMID:25341819] Tamaki S, et al. FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10 [PMID:25675495] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]