PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g39906.1
Common NameLOC4341453, Os06g0601000, OSNPB_060601000, P0457B11.16, P0486H12.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 317aa    MW: 35126.6 Da    PI: 4.6753
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g39906.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-09248295653
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       +++k qle+Le+++ +++ p+ +++  + + ++L+ + +  WF  rR 
  LOC_Os06g39906.1 248 RLKKVQLETLERVYSRTKRPTNTMISSIVQVTSLPRKTIVKWFEDRRE 295
                       67899*****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000862.23E-6243294No hitNo description
SMARTSM003898.1E-4246304IPR001356Homeobox domain
SuperFamilySSF466898.55E-9246297IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-9247295IPR009057Homeodomain-like
PfamPF000469.1E-7248295IPR001356Homeobox domain
PROSITE profilePS500719.167253300IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAAMVGAPLA VAAAAAAPGA RVFLARPLLR RSPRGVACAL RRRPSKYKNK IQNEEVVVED  60
DIGGGGEDDD DALEALFKQL EEDLKNDDLS VEDDDDGISE EDMARFEQEL AEAIGDIADA  120
DESGEGSSLG SEAYGNDEKT DEIKRPELKN WQLKRLARAL KIGRRKTSIK NLAGELGLDR  180
TLVIELLRNP PPKLLFMSDS LPDEDPSKPE IKEIEPSPVV DNADVTETKP QTELPVHVMC  240
AEWSSQKRLK KVQLETLERV YSRTKRPTNT MISSIVQVTS LPRKTIVKWF EDRREQDGVP  300
DHRVAFKRSL SETIAS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.263971e-169flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ69XL0
Functional Description ? help Back to Top
Source Description
UniProtMay modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g39906.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g39906
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0713300.0AK071330.1 Oryza sativa Japonica Group cDNA clone:J023089G15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643619.10.0protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
SwissprotQ8H0V51e-64OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLA0A0E0HT680.0A0A0E0HT68_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PZU80.0A0A0E0PZU8_ORYRU; Uncharacterized protein
TrEMBLB8B4C60.0B8B4C6_ORYSI; Uncharacterized protein
TrEMBLQ69XL00.0Q69XL0_ORYSJ; Os06g0601000 protein
STRINGORUFI06G21620.10.0(Oryza rufipogon)
STRINGOS06T0601000-010.0(Oryza sativa)
STRINGONIVA06G23990.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Representative plantOGRP69271618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-60overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  2. García-Andrade J,Ramírez V,López A,Vera P
    Mediated plastid RNA editing in plant immunity.
    PLoS Pathog., 2013. 9(10): p. e1003713
    [PMID:24204264]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Gamir J,Pastor V,Kaever A,Cerezo M,Flors V
    Targeting novel chemical and constitutive primed metabolites against Plectosphaerella cucumerina.
    Plant J., 2014. 78(2): p. 227-40
    [PMID:24506441]