PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os05g51160.1 | ||||||||
Common Name | LOC4339780, Os05g0589400, OSJNBa0022J22.2, OSNPB_050589400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 271aa MW: 28492.5 Da PI: 8.6071 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.1 | 2e-13 | 120 | 164 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W+++E+ l++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qk+ LOC_Os05g51160.1 120 PWSEQEHRLFLAGLEKLGKGDWRGISRSFVTTRTPTQVASHAQKF 164 8******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.439 | 113 | 169 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.47E-16 | 114 | 170 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.6E-17 | 116 | 167 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.6E-10 | 117 | 160 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.8E-10 | 117 | 167 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-10 | 120 | 163 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.01E-9 | 120 | 165 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006338 | Biological Process | chromatin remodeling | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0035066 | Biological Process | positive regulation of histone acetylation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity | ||||
GO:0004402 | Molecular Function | histone acetyltransferase activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020104 | anatomy | leaf sheath |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 271 aa Download sequence Send to blast |
MHAIMARRCS GDYSTAGQRA GEEGGGGGGA GLRLFGVQLH AAAASSPASY LHKSYSMDCL 60 RLQVSSPSSL QSSSSSPSPL TSSLLLSIDE GCERPAADGY LSDGPHGAAA TMRERKKGVP 120 WSEQEHRLFL AGLEKLGKGD WRGISRSFVT TRTPTQVASH AQKFFLRHNS AAKKTNNKRR 180 SSLFDMVQDC DSGGRSLASS DPATRCNNNI SASLSLQVSH HKSGDSAWPS SETPSVSEAQ 240 QGHGYGTSHH CSPLDLELGM SLSTTPSIGT * |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.54536 | 0.0 | leaf| panicle| root| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32990751 | 0.0 | ||||
Expression Atlas | Q6I5E6 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os05g51160.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os05g51160 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK059813 | 0.0 | AK059813.1 Oryza sativa Japonica Group cDNA clone:006-205-B05, full insert sequence. | |||
GenBank | AK068595 | 0.0 | AK068595.1 Oryza sativa Japonica Group cDNA clone:J013154K05, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015638259.1 | 0.0 | transcription factor MYBS3-like | ||||
Swissprot | Q7XC57 | 5e-37 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | I1PYG4 | 0.0 | I1PYG4_ORYGL; Uncharacterized protein | ||||
TrEMBL | Q6I5E6 | 0.0 | Q6I5E6_ORYSJ; MYB-related transcription factor | ||||
STRING | OS05T0589400-01 | 0.0 | (Oryza sativa) | ||||
STRING | ORGLA05G0241200.1 | 0.0 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4932 | 30 | 66 | Representative plant | OGRP394 | 16 | 99 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47390.1 | 2e-38 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os05g51160.1 |
Entrez Gene | 4339780 |
Publications ? help Back to Top | |||
---|---|---|---|
|