PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os05g46020.1 | ||||||||
Common Name | LOC4339451, OJ1741_B01.16, Os05g0537100, OsJ_19359, OSNPB_050537100, WRKY7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 222aa MW: 23174.4 Da PI: 7.141 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.5 | 2.1e-31 | 134 | 192 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+Hnh LOC_Os05g46020.1 134 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDKDDPSYVVTTYEGTHNHV 192 59********************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.4E-34 | 120 | 194 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.4E-28 | 126 | 194 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.732 | 129 | 194 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.6E-35 | 134 | 193 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.5E-25 | 135 | 191 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0007042 | developmental stage | whole plant fruit formation stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MAAVGAHAAV YHHPVSGLSA PAGDAAYSMS SYFSHGGSST SSSASSFSAA LAAATTPPLP 60 DPSGSQFDIS EFFFDDAPPA AVFNGAPTAA LPDGAAANAT RSAAEAVPAP APAAVERPRT 120 ERIAFRTKSE IEILDDGYKW RKYGKKSVKN SPNPRNYYRC STEGCNVKKR VERDKDDPSY 180 VVTTYEGTHN HVSPSTVYYA SQDAASGRFF VAGTQPPGSL N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-26 | 124 | 195 | 7 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-26 | 124 | 195 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.8961 | 0.0 | callus| leaf| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 297604823 | 0.0 | ||||
Expression Atlas | Q6IES4 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os05g46020.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os05g46020 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ298179 | 0.0 | DQ298179.1 Oryza sativa WRKY transcription factor 7 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015637886.1 | 1e-159 | probable WRKY transcription factor 50 | ||||
Swissprot | Q93WU9 | 6e-41 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A0D3GA84 | 1e-158 | A0A0D3GA84_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0HHD1 | 1e-158 | A0A0E0HHD1_ORYNI; Uncharacterized protein | ||||
TrEMBL | A0A0E0PQH5 | 1e-158 | A0A0E0PQH5_ORYRU; Uncharacterized protein | ||||
TrEMBL | Q20DQ1 | 1e-158 | Q20DQ1_ORYSA; WRKY transcription factor 7 | ||||
TrEMBL | Q6IES4 | 1e-158 | Q6IES4_ORYSJ; Os05g0537100 protein | ||||
STRING | ORUFI05G25660.1 | 1e-159 | (Oryza rufipogon) | ||||
STRING | OS05T0537100-00 | 1e-159 | (Oryza sativa) | ||||
STRING | ONIVA05G24830.1 | 1e-159 | (Oryza nivara) | ||||
STRING | OBART05G24090.1 | 1e-159 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 7e-40 | WRKY DNA-binding protein 51 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os05g46020.1 |
Entrez Gene | 4339451 |
Publications ? help Back to Top | |||
---|---|---|---|
|