PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LOC_Os05g11380.2

Organism

Oryza sativa subsp. japonica

Taxonomic ID

39947

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

M-type_MADS

Protein Properties

Length: 116aa MW: 12597 Da PI: 4.4509

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LOC_Os05g11380.2	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.3	8.6e-28	35	84	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ie++ rqvtf+kR ng+lKKA+ELS LCdaeva+i+fss+g+lyeys+ LOC_Os05g11380.2 35 SIEDTADRQVTFCKRCNGLLKKAYELSMLCDAEVALIVFSSRGRLYEYSN 84 8***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.9E-24	26	85	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	25.525	26	86	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-24	28	48	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.92E-26	34	99	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.6E-25	36	82	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.70E-36	36	100	No hit	No description
PRINTS	PR00404	7.1E-24	48	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-24	63	84	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MHIYKEQEAE PSTGLMMPEP APAASPGSGS SEGSSIEDTA DRQVTFCKRC NGLLKKAYEL 60 SMLCDAEVAL IVFSSRGRLY EYSNNSVEET IERYKKANSD TSNTSTVAEI NAQVY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
1tqe_R	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
1tqe_S	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
6c9l_A	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
6c9l_B	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
6c9l_C	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
6c9l_D	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
6c9l_E	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
6c9l_F	2e-17	27	94	2	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.85124	1e-179	flower

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in lodicules, stamens, carpels and ovules during their development. {ECO:0000269\|PubMed:16326928}.
Uniprot	TISSUE SPECIFICITY: Expressed in the lodicule, stamen carpel and ovule primordia.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LOC_Os05g11380.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
RiceGE	Os05g11380

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC135920	1e-113	AC135920.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0015G13, complete sequence.
GenBank	AP014961	1e-113	AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBank	CP012613	1e-113	CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025881105.1	8e-80	MADS-box transcription factor 58-like isoform X1
Refseq	XP_025881106.1	8e-80	MADS-box transcription factor 58-like isoform X2
Swissprot	Q2V0P1	9e-60	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A0E0PIS3	2e-78	A0A0E0PIS3_ORYRU; Uncharacterized protein
TrEMBL	B8AZ83	2e-78	B8AZ83_ORYSI; Uncharacterized protein
STRING	ORUFI05G07090.1	3e-79	(Oryza rufipogon)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	5e-44	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	LOC_Os05g11380.2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]