PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os04g45690.1 | ||||||||
Common Name | LOC4336535, Os04g0540200, OsJ_15624, OSJNBa0011L07.9, OSNPB_040540200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 251aa MW: 26733.8 Da PI: 4.8996 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 19.7 | 1.8e-06 | 4 | 43 | 5 | 38 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 C+ + + ++ fC ++ lC+ C H+ H+ LOC_Os04g45690.1 4 QCDVCAAEAASVFCCADEAALCDACDRRVHSAnklagkHR 43 7**************************9996566777776 PP | |||||||
2 | zf-B_box | 26.7 | 1.2e-08 | 59 | 92 | 2 | 35 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 +++ C+ ++ek+ lfC++++ lC++C ++ H LOC_Os04g45690.1 59 KPPLCDICQEKRGFLFCKEDRAILCRECDVTVHT 92 6899***************************994 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00336 | 3.0E-11 | 1 | 47 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.84 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.49E-7 | 3 | 47 | No hit | No description |
Pfam | PF00643 | 2.0E-5 | 4 | 44 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 4.8E-13 | 58 | 105 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 10.04 | 58 | 105 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 3.9E-7 | 59 | 92 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.60E-8 | 61 | 105 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009641 | Biological Process | shade avoidance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000989 | Molecular Function | transcription factor activity, transcription factor binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020039 | anatomy | leaf lamina |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 251 aa Download sequence Send to blast |
MKVQCDVCAA EAASVFCCAD EAALCDACDR RVHSANKLAG KHRRFSLLQP LASSSSAQKP 60 PLCDICQEKR GFLFCKEDRA ILCRECDVTV HTTSELTRRH GRFLLTGVRL SSAPMDSPAP 120 SEEEEEEAGE DYSCSPSSVA GTAAGSASDG SSISEYLTKT LPGWHVEDFL VDEATAASSS 180 SDGLFQGGLL AQIGGVPDGY AAWAGREQLH SGVAVAADER ASRERWVPQM NAEWGAGSKR 240 PRASPPCLYW * |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.5890 | 0.0 | callus| leaf| panicle| root| seed| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 116640804 | 0.0 | ||||
Expression Atlas | Q7XR92 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that acts as positive regulator of seedling photomorphogenesis (PubMed:17965270). Acts downstream of COP1 and play an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). {ECO:0000269|PubMed:17965270, ECO:0000269|PubMed:21070414}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os04g45690.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os04g45690 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK061333 | 0.0 | AK061333.1 Oryza sativa Japonica Group cDNA clone:006-303-A11, full insert sequence. | |||
GenBank | CT830169 | 0.0 | CT830169.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA102E21, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015634023.1 | 0.0 | B-box zinc finger protein 20 isoform X2 | ||||
Swissprot | Q9LQZ7 | 1e-54 | BBX21_ARATH; B-box zinc finger protein 21 | ||||
TrEMBL | A2XVZ8 | 0.0 | A2XVZ8_ORYSI; Uncharacterized protein | ||||
TrEMBL | Q7XR92 | 0.0 | Q7XR92_ORYSJ; AP2-EREBP transcription factor | ||||
STRING | OS04T0540200-01 | 0.0 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2392 | 36 | 79 | Representative plant | OGRP2984 | 11 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75540.1 | 4e-29 | salt tolerance homolog2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os04g45690.1 |
Entrez Gene | 4336535 |