Basic
Information? help
Back to Top |
TF ID |
LOC_Os03g54160.1 |
Common Name | AGL10, LOC4334140, MADS14, OJ1112_G08.13, Os03g0752800, OsJ_12598, OSJNBa0032E21.04, OSJNBa0047E24.2, RAP1B |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
Family |
MIKC_MADS |
Protein Properties |
Length: 254aa MW: 29212.4 Da PI: 9.3233 |
Description |
MIKC_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
LOC_Os03g54160.1 | genome | MSU | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 96.5 | 1.2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyey++
LOC_Os03g54160.1 9 KRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYAT 59
79***********************************************86 PP
|
2 | K-box | 105.9 | 4.8e-35 | 79 | 171 | 5 | 97 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97
s+e+ ++ ++++e++kLk+++e++q+ q+hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++l+le+i+elq+kek+lqeenk L+k+
LOC_Os03g54160.1 79 VLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKE 171
55567788899******************************************************************************9986 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
PROSITE profile | PS50066 | 32.941 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.58E-34 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.99E-41 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 1.9E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.3E-30 | 84 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.556 | 88 | 185 | IPR002487 | Transcription factor, K-box |
Publications
? help Back to Top |
- Moon YH, et al.
Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol., 1999. 120(4): p. 1193-204 [PMID:10444103] - Jia H, et al.
Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] - Kyozuka J,Kobayashi T,Morita M,Shimamoto K
Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes. Plant Cell Physiol., 2000. 41(6): p. 710-8 [PMID:10945340] - Lim J,Moon YH,An G,Jang SK
Two rice MADS domain proteins interact with OsMADS1. Plant Mol. Biol., 2000. 44(4): p. 513-27 [PMID:11197326] - Jang S,An K,Lee S,An G
Characterization of tobacco MADS-box genes involved in floral initiation. Plant Cell Physiol., 2002. 43(2): p. 230-8 [PMID:11867703] - Favaro R, et al.
Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants. Mol. Genet. Genomics, 2002. 268(2): p. 152-9 [PMID:12395189] - Cooper B, et al.
A network of rice genes associated with stress response and seed development. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50 [PMID:12684538] - Kim SL,Lee S,Kim HJ,Nam HG,An G
OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] - Li D, et al.
Functional characterization of rice OsDof12. Planta, 2009. 229(6): p. 1159-69 [PMID:19198875] - Ryu CH, et al.
OsMADS50 and OsMADS56 function antagonistically in regulating long day (LD)-dependent flowering in rice. Plant Cell Environ., 2009. 32(10): p. 1412-27 [PMID:19558411] - Tanaka N, et al.
The COP1 ortholog PPS regulates the juvenile-adult and vegetative-reproductive phase changes in rice. Plant Cell, 2011. 23(6): p. 2143-54 [PMID:21705640] - Kobayashi K, et al.
Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] - Ren D, et al.
MULTI-FLORET SPIKELET1, which encodes an AP2/ERF protein, determines spikelet meristem fate and sterile lemma identity in rice. Plant Physiol., 2013. 162(2): p. 872-84 [PMID:23629832] - Wei X, et al.
Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] - Su L,Shan JX,Gao JP,Lin HX
OsHAL3, a Blue Light-Responsive Protein, Interacts with the Floral Regulator Hd1 to Activate Flowering in Rice. Mol Plant, 2016. 9(2): p. 233-244 [PMID:26537047] - Wu F, et al.
The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]
|