PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os03g51690.2 | ||||||||
Common Name | LOC4333973, Os03g0727000, OSH1, OSJNBa0013A09.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 362aa MW: 39898 Da PI: 6.8667 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 26.9 | 8e-09 | 284 | 322 | 17 | 55 |
HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 el +k +yps++++ LA+++gL+ +q+ +WF N+R ++ LOC_Os03g51690.2 284 ELHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRH 322 5566789*****************************885 PP | |||||||
2 | ELK | 37.1 | 6.7e-13 | 242 | 263 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELKh+Ll+KYsgyL+sLkqE+s LOC_Os03g51690.2 242 ELKHHLLKKYSGYLSSLKQELS 263 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 2.1E-22 | 102 | 146 | IPR005540 | KNOX1 |
Pfam | PF03790 | 2.2E-23 | 103 | 144 | IPR005540 | KNOX1 |
SMART | SM01256 | 3.7E-28 | 153 | 204 | IPR005541 | KNOX2 |
Pfam | PF03791 | 1.1E-22 | 159 | 202 | IPR005541 | KNOX2 |
SMART | SM01188 | 1800 | 162 | 182 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.331 | 242 | 262 | IPR005539 | ELK domain |
Pfam | PF03789 | 8.2E-10 | 242 | 263 | IPR005539 | ELK domain |
SMART | SM01188 | 4.9E-7 | 242 | 263 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.617 | 262 | 325 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.82E-19 | 263 | 338 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 8.5E-13 | 264 | 329 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-27 | 267 | 326 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.29E-12 | 274 | 326 | No hit | No description |
Pfam | PF05920 | 3.0E-16 | 282 | 321 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 300 | 323 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009049 | anatomy | inflorescence | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 362 aa Download sequence Send to blast |
MEEISHHFGV VGASGVHGGH QHQHHHHPWG SSLSAIVAPP PPPQLQQQQT QAGGMAHTPL 60 TLNTAAAAVG NPVLQLANGS LLDACGKAKE ASASASYAAD VEAIKAKIIS HPHYSSLLAA 120 YLDCQKVGAP PEVAARLTAV AQDLELRQRT ALGVLGAATE PELDQFMEAY HEMLVKYREE 180 LTRPLQEAME FLRRVETQLN TLSISGRSLR NILSSGSSEE DQEGSGGETE LPEIDAHGVD 240 QELKHHLLKK YSGYLSSLKQ ELSKKKKKGK LPKDARQQLL NWWELHYKWP YPSESQKVAL 300 AESTGLDLKQ INNWFINQRK RHWKPSDEMQ FVMMDGYHPT NAAAFYMDGH FINDGGLYRL 360 G* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.151 | 0.0 | panicle| root| stem| vegetative meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 452235 | 0.0 | ||||
Expression Atlas | P46609 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the globular stage embryo 2 days after pollination (DAP) in a restricted small region just below the center of the ventral region of the embryo, where the shoot apex arises later. From 3 to 4 DAP expressed in an enlarged ventral region of embryo, corresponding to the expected epiblast and radicle, respectively. At the shoot apex differentiation stage (4-5 DAP), expressed in the shoot apex, epiblast, radicle primordia, and in their intervening tissues. Expression in the radicle is observed in the cells surrounding the root apical meristem in a donut shape but not in the meristem. During the first and second leaf primordium formation, expression pattern is maintained, but decreases. During inflorescence development, expressed only in the corpus of the rachis primordium but not in the tunica layer (L1). After floral induction, expressed in both tunica and corpus but not in floral organ primordia. Later in flower development, expressed in the corpus of the floral meristem. {ECO:0000269|PubMed:10488233, ECO:0000269|PubMed:8755613, ECO:0000269|PubMed:9869405}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed predominantly in shoot apices. Also found to a lesser extent in glumes. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that regulates genes involved in development. May be involved in shoot formation during embryogenesis. Overexpression in transgenic plants causes altered leaf morphology (PubMed:10488233, PubMed:8755613, PubMed:9869405). Regulates anther dehiscence via direct repression of the auxin biosynthetic gene YUCCA4 (PubMed:29915329). Binds to the DNA sequence 5'-TGAC-3' in the promoter of the YUCCA4 gene and represses its activity during anther development (PubMed:29915329). Reduction of auxin levels at late stage of anther development, after meiosis of microspore mother cells, is necessary for normal anther dehiscence and seed setting (PubMed:29915329). {ECO:0000269|PubMed:10488233, ECO:0000269|PubMed:29915329, ECO:0000269|PubMed:8755613, ECO:0000269|PubMed:9869405}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00675 | ChIP-seq | Transfer from GRMZM2G017087 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os03g51690.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os03g51690 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ940206 | 0.0 | FJ940206.1 Oryza sativa Japonica Group clone KCB522D03 homeobox protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015629392.1 | 0.0 | homeobox protein knotted-1-like 6 | ||||
Swissprot | P46609 | 0.0 | KNOS6_ORYSJ; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | D6BV17 | 0.0 | D6BV17_ORYSJ; Homeobox protein | ||||
STRING | ORGLA03G0296100.1 | 0.0 | (Oryza glaberrima) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 1e-96 | KNOTTED-like from Arabidopsis thaliana |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os03g51690.2 |
Entrez Gene | 4333973 |