PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os03g48970.4 | ||||||||
Common Name | Os03g0696300, OSNPB_030696300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 247aa MW: 26606.5 Da PI: 8.7304 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.8 | 3.7e-33 | 162 | 218 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e ekk+ ksrkpylheSRh+hA+rR+Rg+gGrF LOC_Os03g48970.4 162 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-VKSRKPYLHESRHQHAMRRARGTGGRF 218 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.5E-37 | 160 | 221 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.398 | 161 | 221 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.1E-29 | 163 | 218 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 7.3E-25 | 164 | 186 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 166 | 186 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 7.3E-25 | 195 | 218 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0055046 | Biological Process | microgametogenesis | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020039 | anatomy | leaf lamina |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MESRPGGTNL VEPRGQGALP SGIPIQQPWW TTSAGVGAVS PAVVAPGSGA GISLSGRDGG 60 GDDAAEESSD DSRRSGETKD GSTDQEKHHA TSQMTALASD YLTPFSQLEL NQPIASAAYQ 120 YPDSYYMGMV GPYGPQAMSA QTHFQLPGLT HSRMPLPLEI SEEPVYVNAK QYHGILRRRQ 180 SRAKAELEKK VVKSRKPYLH ESRHQHAMRR ARGTGGRFLN TKKNEDGAPS EKAEPNKELR 240 VSPDPS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-21 | 162 | 225 | 2 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.7928 | 0.0 | callus| flower| leaf| panicle| root| stem| vegetative meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32979878 | 0.0 | ||||
Expression Atlas | A0A0P0W2B5 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence, stems, flowers and siliques. {ECO:0000269|PubMed:11867211}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os03g48970.4 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os03g48970 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB288030 | 0.0 | AB288030.1 Oryza sativa Japonica Group OsHAP2D mRNA for HAP2 subunit of HAP complex, complete cds. | |||
GenBank | AK069854 | 0.0 | AK069854.1 Oryza sativa Japonica Group cDNA clone:J023036P10, full insert sequence. | |||
GenBank | EU847012 | 0.0 | EU847012.1 Oryza sativa Japonica Group clone KCS256D08 CCAAT-binding transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015632638.1 | 0.0 | nuclear transcription factor Y subunit A-9 isoform X2 | ||||
Swissprot | Q945M9 | 7e-40 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
TrEMBL | A0A0P0W2B5 | 1e-173 | A0A0P0W2B5_ORYSJ; Os03g0696300 protein (Fragment) | ||||
TrEMBL | Q10EQ4 | 1e-173 | Q10EQ4_ORYSJ; CCAAT-binding transcription factor | ||||
STRING | OS03T0696300-01 | 1e-174 | (Oryza sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 1e-41 | nuclear factor Y, subunit A9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os03g48970.4 |
Publications ? help Back to Top | |||
---|---|---|---|
|