PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os03g07880.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 167aa MW: 18637.4 Da PI: 11.0203 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 108 | 7.7e-34 | 64 | 120 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq Rakle+e+kl k+rkpylheSRh+hA++R+Rg+gGrF LOC_Os03g07880.3 64 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKNRKPYLHESRHQHAMKRARGTGGRF 120 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.8E-39 | 62 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.283 | 63 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.6E-29 | 65 | 120 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.9E-25 | 66 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 68 | 88 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.9E-25 | 97 | 120 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MSRMINLVIL MVTRRVMKGI SYPYADSFYG GAVATYGTHA IMHPQIVGVM SSSRVPLPIE 60 PATEEPIYVN AKQYHAILRR RQLRAKLEAE NKLVKNRKPY LHESRHQHAM KRARGTGGRF 120 LNTKQQPEAS DGGTPRLVSA NGVVFSKHEH SLSSSDLHHR RAKEGA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-25 | 64 | 134 | 2 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.3426 | 0.0 | callus| flower| leaf| panicle| root| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | Q10R13 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os03g07880.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os03g07880 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB288029 | 0.0 | AB288029.1 Oryza sativa Japonica Group OsHAP2C mRNA for HAP2 subunit of HAP complex, complete cds. | |||
GenBank | AK069348 | 0.0 | AK069348.1 Oryza sativa Japonica Group cDNA clone:J023014B08, full insert sequence. | |||
GenBank | CT832705 | 0.0 | CT832705.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA105G23, full insert sequence. | |||
GenBank | EU847006 | 0.0 | EU847006.1 Oryza sativa Japonica Group clone KCS364E08 CCAAT-binding transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015631822.1 | 1e-106 | nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q9LNP6 | 3e-37 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | Q10R13 | 1e-119 | Q10R13_ORYSJ; CCAAT-binding transcription factor subunit B family protein, expressed | ||||
STRING | OS03T0174900-01 | 1e-106 | (Oryza sativa) | ||||
STRING | ONIVA03G05390.1 | 1e-105 | (Oryza nivara) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17590.4 | 2e-39 | nuclear factor Y, subunit A8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os03g07880.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|