PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LOC_Os02g58670.1

Common Name

LOC4331270, OJ1282_E10.14, Os02g0833600, OsJ_09015, OSNPB_020833600

Organism

Oryza sativa subsp. japonica

Taxonomic ID

39947

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

bZIP

Protein Properties

Length: 143aa MW: 15220.2 Da PI: 9.7924

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LOC_Os02g58670.1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.2	2.7e-16	67	127	1	61
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 e+e ++++r++kNRe+A rsR+RK+a+++eLe++v L +eN +Lk ++lk e+a+l + LOC_Os02g58670.1 67 EEEERKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRHCKQLKTEMAALIQ 127 678899************************************************9998865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	9.1E-17	65	128	No hit	No description
PRINTS	PR00041	1.7E-5	66	82	IPR001630	cAMP response element binding (CREB) protein
Pfam	PF00170	9.5E-14	67	127	IPR004827	Basic-leucine zipper domain
SMART	SM00338	4.7E-14	67	131	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.507	69	125	IPR004827	Basic-leucine zipper domain
CDD	cd14707	6.10E-15	71	125	No hit	No description
SuperFamily	SSF57959	1.24E-12	71	128	No hit	No description
PRINTS	PR00041	1.7E-5	84	104	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	1.7E-5	104	121	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0020039	anatomy	leaf lamina

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MAEQLGGVGS PQLSLSSCSS FLSISSAGTS AADGAPHLSL GVGGAEELDL LLQVGIGGGG 60 GGGGDEEEEE RKTIRMMKNR ESALRSRARK RAYVQELEKE VRRLVNENLK LKRHCKQLKT 120 EMAALIQQPT NKQSSHRRSS ST*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.18354	0.0	callus\| leaf\| panicle\| stem

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	Q6ESB3

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980, ECO:0000269\|PubMed:25661797}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LOC_Os02g58670.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
RiceGE	Os02g58670

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK061086	0.0	AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015623884.1	2e-97	protein FD
Swissprot	Q84JK2	2e-14	FD_ARATH; Protein FD
TrEMBL	A0A0D3FCJ0	5e-96	A0A0D3FCJ0_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0GFF8	5e-96	A0A0E0GFF8_ORYNI; Uncharacterized protein
TrEMBL	A0A0E0NNE1	5e-96	A0A0E0NNE1_ORYRU; Uncharacterized protein
TrEMBL	A2XBE0	5e-96	A2XBE0_ORYSI; Uncharacterized protein
TrEMBL	I1P5X3	5e-96	I1P5X3_ORYGL; Uncharacterized protein
TrEMBL	Q6ESB3	5e-96	Q6ESB3_ORYSJ; Os02g0833600 protein
STRING	ORUFI02G40230.1	8e-97	(Oryza rufipogon)
STRING	OS02T0833600-01	8e-97	(Oryza sativa)
STRING	ONIVA02G41380.1	8e-97	(Oryza nivara)
STRING	ORGLA02G0337900.1	8e-97	(Oryza glaberrima)
STRING	OBART02G38520.1	8e-97	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4017	30	72
Representative plant	OGRP9528	5	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	2e-15	bZIP family protein

Link Out ? help Back to Top
Phytozome	LOC_Os02g58670.1
Entrez Gene	4331270

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]