Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 100.1 | 8.5e-32 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+
LOC_Os02g45770.1 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
79**********************************************95 PP
|
2 | K-box | 105.8 | 5.4e-35 | 76 | 171 | 4 | 99 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96
+++++++ ++++s+++e++kLk++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke++l e+n++L++
LOC_Os02g45770.1 76 AQDSNNALSETQSWYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKH 168
45555778889********************************************************************************** PP
K-box 97 kle 99
kle
LOC_Os02g45770.1 169 KLE 171
986 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
PROSITE profile | PS50066 | 33.571 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.74E-45 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 2.49E-33 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-30 | 84 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.55 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009553 | Biological Process | embryo sac development |
GO:0009911 | Biological Process | positive regulation of flower development |
GO:0010094 | Biological Process | specification of carpel identity |
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0030154 | Biological Process | cell differentiation |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:0048455 | Biological Process | stamen formation |
GO:0048459 | Biological Process | floral whorl structural organization |
GO:0048509 | Biological Process | regulation of meristem development |
GO:0048833 | Biological Process | specification of floral organ number |
GO:0080060 | Biological Process | integument development |
GO:0080112 | Biological Process | seed growth |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0005515 | Molecular Function | protein binding |
GO:0046983 | Molecular Function | protein dimerization activity |
Publications
? help Back to Top |
- Moon YH, et al.
Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol., 1999. 120(4): p. 1193-204 [PMID:10444103] - Masiero S, et al.
Ternary complex formation between MADS-box transcription factors and the histone fold protein NF-YB. J. Biol. Chem., 2002. 277(29): p. 26429-35 [PMID:11971906] - Favaro R, et al.
Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants. Mol. Genet. Genomics, 2002. 268(2): p. 152-9 [PMID:12395189] - Cooper B, et al.
A network of rice genes associated with stress response and seed development. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50 [PMID:12684538] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Lee S, et al.
Alteration of floral organ identity in rice through ectopic expression of OsMADS16. Planta, 2003. 217(6): p. 904-11 [PMID:12905025] - Fornara F, et al.
Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes. Plant Physiol., 2004. 135(4): p. 2207-19 [PMID:15299121] - Ohmori S, et al.
MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice. Plant Cell, 2009. 21(10): p. 3008-25 [PMID:19820190] - Li H, et al.
The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] - Zhang J,Nallamilli BR,Mujahid H,Peng Z
OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] - Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U
Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] - Duan Y, et al.
Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] - Conrad LJ, et al.
The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] - Zhang J, et al.
Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] - Bai X, et al.
Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] - Zhang B, et al.
A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609] - Tao J,Liang W,An G,Zhang D
OsMADS6 Controls Flower Development by Activating Rice FACTOR OF DNA METHYLATION LIKE1. Plant Physiol., 2018. 177(2): p. 713-727 [PMID:29717020]
|