PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g30700.1
Common NameLOC107275548, Os02g0511200, OsJ_06874, OSJNBa0001A11.14, OSNPB_020511200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 277aa    MW: 29091.8 Da    PI: 6.3675
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g30700.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-13176219447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT eE+ ++++++  +G+g+Wk+ a+++ k+++  q+ s++qk+
  LOC_Os02g30700.1 176 WTREEHSQFLHGISTYGKGNWKALASEFVKTKSSTQIASHYQKF 219
                       ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.12878IPR001005SANT/Myb domain
SuperFamilySSF466894.74E-73077IPR009057Homeodomain-like
PROSITE profilePS500905.4943276IPR017877Myb-like domain
CDDcd001672.34E-43272No hitNo description
PROSITE profilePS5129412.687168224IPR017930Myb domain
SuperFamilySSF466894.74E-14169225IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-11171221IPR006447Myb domain, plants
SMARTSM007173.2E-8172222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-9175219IPR009057Homeodomain-like
PfamPF002492.6E-10176218IPR001005SANT/Myb domain
CDDcd001671.60E-8176219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MPTDDATATG NGDGAAPRPA AAEPAAPLSS VWTRRDEKLL EMLLWRWQLD PHWDRLAAEL  60
GGKTATQVFD RYVCLADELR LVMAAPAVDT PPAWDVQDER EAAVAPLPGL EADAAAGAGE  120
SAEVTAIGIA AAASPNAAAT SAPTIGGGVV LKSRELKNPR KTRMAGGGPR KKAEMWTREE  180
HSQFLHGIST YGKGNWKALA SEFVKTKSST QIASHYQKFC IREEKRRLSK CKRASIHDIV  240
SPTTTTSAPE SAGAGPSAPP CALIESGALI AGDDDA*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6K786
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g30700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g30700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0048610.0AP004861.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0001A11.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624449.10.0transcription factor SRM1
TrEMBLQ6K7860.0Q6K786_ORYSJ; Myb-like protein
STRINGORUFI02G18860.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144181825
Representative plantOGRP1784722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-17MYB family protein